Property Summary

NCBI Gene PubMed Count 7
PubMed Score 6.42
PubTator Score 1.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.2e-03
subependymal giant cell astrocytoma 2287 3.6e-02
spina bifida 1074 3.7e-02
Disease Target Count Z-score Confidence
Brucellosis 24 4.399 2.2

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.081 1.2e-03
spina bifida -1.401 3.7e-02
subependymal giant cell astrocytoma -1.185 3.6e-02

Gene RIF (1)

AA Sequence

MARRPRNSRAWHFVLSAARRDADARAVALAGSTNWGYDSDGQHSDSDSDPEYSTLPPSIPSAVPVTGESF      1 - 70
CDCAGQSEASFCSSLHSAHRGRDCRCGEEDEYFDWVWDDLNKSSATLLSCDNRKVSFHMEYSCGTAAIRG     71 - 140
TKELGEGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKYRHTFCSLLGRDEDSWGLSYTGLLHHKGDKTSF    141 - 210
SSRFGQGSIIGVHLDTWHGTLTFFKNRKCIGVAATKLQNKRFYPMVCSTAARSSMKVTRSCASATSLQYL    211 - 280
CCHRLRQLRPDSGDTLEGLPLPPGLKQVLHNKLGWVLSMSCSRRKAPVSDPQAATSAHPSSREPRPCQRK    281 - 350
RCRRT                                                                     351 - 355
//

Text Mined References (8)

PMID Year Title