Property Summary

NCBI Gene PubMed Count 7
PubMed Score 9.25
PubTator Score 1.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 1.2e-03
subependymal giant cell astrocytoma 2287 3.6e-02
spina bifida 1064 3.7e-02
Disease Target Count Z-score Confidence
Brucellosis 24 3.152 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.081 1.2e-03
subependymal giant cell astrocytoma -1.185 3.6e-02
spina bifida -1.401 3.7e-02

Synonym

Accession Q6PJ21 D3DU78 Q49A96 Q86X18 Q8WXK5 Q96IE6 Q96RY2 SSB-3
Symbols SSB3
C16orf31

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
20532202 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MARRPRNSRAWHFVLSAARRDADARAVALAGSTNWGYDSDGQHSDSDSDPEYSTLPPSIPSAVPVTGESF      1 - 70
CDCAGQSEASFCSSLHSAHRGRDCRCGEEDEYFDWVWDDLNKSSATLLSCDNRKVSFHMEYSCGTAAIRG     71 - 140
TKELGEGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKYRHTFCSLLGRDEDSWGLSYTGLLHHKGDKTSF    141 - 210
SSRFGQGSIIGVHLDTWHGTLTFFKNRKCIGVAATKLQNKRFYPMVCSTAARSSMKVTRSCASATSLQYL    211 - 280
CCHRLRQLRPDSGDTLEGLPLPPGLKQVLHNKLGWVLSMSCSRRKAPVSDPQAATSAHPSSREPRPCQRK    281 - 350
RCRRT                                                                     351 - 355
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20532202 2010 Use of genome-wide expression data to mine the "Gray Zone" of GWA studies leads to novel candidate obesity genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15713673 2005 The SPRY domain-containing SOCS box protein 1 (SSB-1) interacts with MET and enhances the hepatocyte growth factor-induced Erk-Elk-1-serum response element pathway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12076535 2002 The SOCS box: a tale of destruction and degradation.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.