Property Summary

NCBI Gene PubMed Count 24
PubMed Score 5.51
PubTator Score 5.90

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

AA Sequence

MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNNDRSLNVFVKED      1 - 70
DKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESW     71 - 140
GWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLY    141 - 210
PVVSAVWGHCEIRMRYLNGLDPEPLPLMDLCRRSVRLALGRERLGEIHTLPLPASLKAYLLYQ           211 - 273
//

Text Mined References (26)

PMID Year Title