Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.16
PubTator Score 4.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -2.100 3.4e-06
astrocytic glioma -1.800 4.9e-03
atypical teratoid / rhabdoid tumor -1.800 3.3e-08
ependymoma -1.900 8.4e-03
glioblastoma -1.500 3.3e-07
group 4 medulloblastoma -1.100 2.0e-03
lung adenocarcinoma -1.100 3.1e-17
medulloblastoma, large-cell -1.900 4.6e-05
non-small cell lung cancer -1.206 3.2e-16
oligodendroglioma -1.500 1.1e-02
osteosarcoma 1.573 6.6e-07
pituitary cancer 1.300 3.2e-06
primitive neuroectodermal tumor -1.200 2.9e-03

Synonym

Accession Q5W111 A8K3G1 O60648 Q8TBG8 Q96T69
Symbols CLLD6
C13orf1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (2)

Gene RIF (1)

AA Sequence

MATSVLCCLRCCRDGGTGHIPLKEMPAVQLDTQHMGTDVVIVKNGRRICGTGGCLASAPLHQNKSYFEFK      1 - 70
IQSTGIWGIGVATQKVNLNQIPLGRDMHSLVMRNDGALYHNNEEKNRLPANSLPQEGDVVGITYDHVELN     71 - 140
VYLNGKNMHCPASGIRGTVYPVVYVDDSAILDCQFSEFYHTPPPGFEKILFEQQIF                  141 - 196
//

Text Mined References (16)

PMID Year Title