Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.200 2.8e-04
atypical teratoid / rhabdoid tumor -1.700 2.1e-11
glioblastoma -1.300 8.0e-10
group 3 medulloblastoma -1.200 1.3e-03
lung carcinoma 1.100 3.0e-26
medulloblastoma, large-cell -2.000 2.4e-06
posterior fossa group A ependymoma -1.100 2.3e-09
primitive neuroectodermal tumor -1.700 3.7e-06
subependymal giant cell astrocytoma -1.061 2.6e-02

AA Sequence

MRRTRRPRFVLMNKMDDLNLHYRFLNWRRRIREIREVRAFRYQERFKHILVDGDTLSYHGNSGEVGCYVA      1 - 70
SRPLTKDSNYFEVSIVDSGVRGTIAVGLVPQYYSLDHQPGWLPDSVAYHADDGKLYNGRAKGRQFGSKCN     71 - 140
SGDRIGCGIEPVSFDVQTAQIFFTKNGKRVGSTIMPMSPDGLFPAVGMHSLGEEVRLHLNAELGREDDSV    141 - 210
MMVDSYEDEWGRLHDVRVCGTLLEYLGKGKSIVDVGLAQARHPLSTRSHYFEVEIVDPGEKCYIALGLAR    211 - 280
KDYPKNRHPGWSRGSVAYHADDGKIFHGSGVGDPFGPRCYKGDIMGCGIMFPRDYILDSEGDSDDSCDTV    281 - 350
ILSPTARAVRNVRNVMYLHQEGEEEEEEEEEEEDGEEIEPEHEGRKVVVFFTRNGKIIGKKDAVVPSGGF    351 - 420
FPTIGMLSCGEKVKVDLHPLSG                                                    421 - 442
//

Text Mined References (6)

PMID Year Title