Property Summary

NCBI Gene PubMed Count 12
PubMed Score 7.78
PubTator Score 3.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

Gene RIF (3)

AA Sequence

MDAAVTDDFQQILPIEQLRSTHASNDYVERPPAPCKQALSSPSLIVQTHKSDWSLATMPTSLPRSLSQCH      1 - 70
QLQPLPQHLSQSSIASSMSHSTTASDQRLLASITPSPSGQSIIRTQPGAGVHPKADGALKGEAEQSAGHP     71 - 140
SEHLFICEECGRCKCVPCTAARPLPSCWLCNQRCLCSAESLLDYGTCLCCVKGLFYHCSTDDEDNCADEP    141 - 210
CSCGPSSCFVRWAAMSLISLFLPCLCCYLPTRGCLHLCQQGYDSLRRPGCRCKRHTNTVCRKISSGSAPF    211 - 280
PKAQEKSV                                                                  281 - 288
//

Text Mined References (13)

PMID Year Title