Property Summary

NCBI Gene PubMed Count 129
PubMed Score 81.53
PubTator Score 116.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
psoriasis -1.800 7.2e-14
medulloblastoma -1.900 6.8e-06
astrocytoma 1.100 4.7e-02
glioblastoma 1.500 1.2e-02
medulloblastoma, large-cell -1.800 2.6e-02
adrenocortical carcinoma -1.058 2.5e-02
Hydrolethalus syndrome 1.469 4.2e-02
lung cancer 1.300 8.0e-03
breast carcinoma -2.100 2.6e-07
interstitial cystitis -1.100 1.3e-02
lung adenocarcinoma -1.100 4.5e-12
subependymal giant cell astrocytoma -1.547 9.4e-03
invasive ductal carcinoma -2.700 4.8e-04
Breast cancer -2.800 8.3e-18
lung carcinoma -1.300 3.2e-12
ductal carcinoma in situ -1.700 1.3e-03
ovarian cancer -2.000 8.1e-03
pituitary cancer -1.400 5.5e-04

Gene RIF (106)

PMID Text
26286024 Data show that proto-oncogene protein B-raf (BRAF) inhibition induces c-Jun N-terminal kinase (c-JUN) expression and c-JUN abundance and activation by down-regulating SPRY2/4 protein expression.
26265114 The purpose of this study was to determine whether SPRY2 might have antiinflammatory effects on rheumatoid arthritis fibroblast-like synoviocytes.
26075267 Cosuppression of Sprouty and Sprouty-related negative regulators of FGF signalling in prostate cancer
26026961 A decrease in SPRY2 and RECK expression by nickel-induced miR-21 may promote invasiveness in lung cancer cells.
25934697 SPRY2, counter to its roles in other cancer settings, promotes glioma cell and tumor growth and cellular resistance to targeted inhibitors of oncogenic RTKs
25782674 Arg119Trp variant in the SPRY2 gene was identified as the probable IgA nephropathy-causing mutation. This variant is responsible for inhibition of the MAPK/ERK1/2 pathway.
25633921 miR21 may represent a negative regulator involved in the downregulation of SPRY2 in MM.
25630587 Sprouty 2 protein, but not Sprouty 4, is an independent prognostic biomarker for human epithelial ovarian cancer.
25533808 This study reveals the loss of SPRY2 in HGSC and indicates an important tumor-suppressive role for SPRY2 in mediating the stimulatory effect of EGF on human EOC progression.
25339627 No association between SPRY2, single-nucleotide polymorphisms, and nonsyndromic cleft lip with or without cleft palate risk were observed in this cohort of patients.
24969401 Results suggest a link between placental SPRY2 mRNA levels and placental growth, which may be modulated by maternal metabolic status and placental inflammation.
24796743 Data indicate that the proliferation and survival rates of HEK293T cells transfected with pDC315/hSPRY2 were significantly higher than those transfected with pDC315/EGFP (green fluorescent proteins).
24554542 involvement of PAX9, EDA, SPRY2, SPRY4, and WNT10A as risk factors for MLIA. uncovered 3 strong synergistic interactions between MLIA liability and MSX1-TGFA, AXIN2-TGFA, and SPRY2-SPRY4 gene pairs. 1st evidence of sprouty genes in MLIA susceptibility.
24469046 CK1 activity and binding are necessary for SPRY2 inhibition of FGF-stimulated neurite outgrowth in PC12 cells
24445374 Mechanistic model of EGFR endocytosis to determine the relative contributions of three parallel pathways of MIG6, ubiquitin ligase CBL and Sprouty2.
24292711 Increased SPRY2 expression during chronic viral infection reduces T cell polyfunctionality.
24292711 SPRY2 upregulation inhibits HIV-1 Gag-, Nef-, and Tat-specific T cell polyfunctionality independently of the PD-1 pathway
24094449 hypothesize that the level of SPRY2 expression contributes to MAPK/ERK pathway output and accounts for BRAF V600E+ and clinical heterogeneity in papillary thyroid cancer
23868981 SPRY2 and MIG6 are important regulators of wild-type and mutant EGFR trafficking and points to an EGFR expression-independent function of SPRY2 in the regulation of ERK activity that may impact cellular sensitivity to EGFR inhibitors
23831057 Sprouty2 (but not Sprouty4) has a role in inhibition of cell proliferation and migration of osteosarcoma cells
23688375 Our results have raised the possibility that Spry2 might play a role in the pathogenesis and progression of renal cell carcinoma.
23650389 miR-27a regulates MET, EGFR, and Sprouty2 in lung cancer.
23649631 Data suggest epidermal growth factor induced the expression of c-MYC, which promoted the expression of mature miR-23a, miR-24-2, and miR-27a and subsequently decreased expression of Sprouty2 (SPRY2).
23624922 we reveal that SPRY2 expression is regulated by FOXO3a and beta-catenin nuclear activity in colon cancer
23573284 SPRY2 is an important regulator of branching morphogenesis and epithelial to mesenchymal transition in the mammary gland.
23434594 SPRY2, PTEN, and PP2A status is an important determinant of prostate cancer progression.
23239100 The ERK-MAPK signaling pathway is regulated by Sprouty2 expression via a miR-21-mediated mechanism during mesenchymal stem cell differentiation.
23074222 siRNA-mediated knockdown of Spry1, Spry2, or Spry4 promotes IFN-inducible antileukemic effects in vitro and results in enhanced suppressive effects on malignant hematopoietic progenitors from patients with polycythemia vera.
22761998 SPRY2 upregulation inhibits HIV-1 Gag-, Nef-, and Tat-specific T cell polyfunctionality independently of the PD-1 pathway
22649008 In conclusion, SPRY2 is an important tumour suppressor in prostate cancer since its loss drives the PI3K/AKT pathway via functional interaction with the ErbB system.
22383529 G Protein-regulated inducer of neurite outgrowth (GRIN) modulates Sprouty protein repression of mitogen-activated protein kinase (MAPK) activation by growth factor stimulation
22158968 ITSN1 binds Pro-rich regions in both Cbl and Spry2, and interaction of ITSN1 with Spry2 disrupts Spry2-Cbl interaction, resulting in enhanced ubiquitylation of the EGFR.
22006925 analysis of regulation of cellular levels of Sprouty2 protein by prolyl hydroxylase domain and von Hippel-Lindau proteins
21909839 A significant association of rs10906115 in CDC123/CAMK1D and rs1359790 near SPRY2 was identified with type 2 diabetes in a Japanese population.
21909357 Low gene expression of Spry2 was associated with increased pathological grade, high HER2 expression, and was a significant independent prognostic factor.
21762810 Spry2 influences IP3R function through control of PI(4,5)P(2) and IP3R influences Spry2 function by controlling its distribution and ERK activation.
21762810 SPRY2 upregulation inhibits HIV-1 Gag-, Nef-, and Tat-specific T cell polyfunctionality independently of the PD-1 pathway
21543492 SPRY2 upregulation inhibits HIV-1 Gag-, Nef-, and Tat-specific T cell polyfunctionality independently of the PD-1 pathway
21364986 Sprouty and Spred proteins are negative regulators of the ERK/Elk-1 pathway activation induced not only by growth-factors, but also by reactive lipidic mediators.
21288888 The SPRY2 is cleavable by FAP and more suitable for investigation of its substrate specificity in the context of the full-length globular protein
21278789 Data suggest that the post-transcriptional regulation of Spry2 by miR-21 has an essential role on the malignant progression of gliomas.
21239886 the electrostatic regulatory interaction between the SPRY2 F loop residues (that bind to imperatoxin A) and the ASI/basic residues of RyR1 does not influence bi-directional DHPR-RyR1 signaling during skeletal EC coupling
21134562 Increased Spry2 expression may serve as a surrogate marker of mitogen-activated protein kinase pathway activation in thyroid cancer with prognostic and therapeutic implications.
21111454 Sprouty 2 promoter methylation was detected in 31 (53.4%) of 58 endometrial carcinomas.
21099344 Spry2 expression is downregulated and miRNA-21 is upregulated in the clinical samples of colon cancer, which correlates with clinical stage of disease. Thus, Spry2 functions as a tumor suppressor in colon cancer.
20956544 insight into the ErbB2-driven anchorage independence of tumor cells and provide a new mechanism for regulation of EGFR and beta1 integrin expression in ECM-detached cells
20934684 SPRY2 is upregulated in human PDLCs subjected to tensile stress related to mechano-induced cell cycle arrest.
20877636 Serine/threonine phosphorylation reduces the binding affinity between the TKB domain of c-Cbl and its target proteins, EGFR and Sprouty2.
20678191 The authors observed that Env of Jaagsiekte sheep retrovirus induced the expression of a tumor suppressor, Sprouty2, suggesting a correlation between Env-effect and Sprouty2 expression.
20661223 in colon cancer sprouty functions as an oncogene and its effects are mediated in part by c-Met upregulation
20638779 Data indicate that miR-27a plays an oncogenic role by targeting Spry2 and modulating the malignant, biological behavior of pancreatic cancer cells.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20624167 Data show that Spry2 can enhance the response of colon cancer cells to gefitinib by increasing the expression of phosphorylated and total EGFR.
20572854 Observational study of gene-disease association. (HuGE Navigator)
20543868 Data demonstrate a tumourigenic action of SPRY2 that is based on the repression of E-cadherin, probably by the induction of ZEB1, and a reciprocal regulation of SPRY2 and E-cadherin that dictates cell phenotype.
20237272 Sprouty2 regulates the mitogen activated protein (MAP) kinase pathway, cell proliferation, and gene expression in the cortex at mid-neurogenesis.
20139419 SPRY2 upregulation inhibits HIV-1 Gag-, Nef-, and Tat-specific T cell polyfunctionality independently of the PD-1 pathway
20123980 Results describe a cellular model of sustained ERK1/2 activation through Sprouty2, which may provide a mechanistic understanding of self-sustained biological processes in chronic illnesses such as asthma.
19864419 Spry1 and Spry2, but not Spry3 or Spry4, associate with the HECT domain family E3 ubiquitin ligase, Nedd4.
19690147 a dual mechanism that affects the Sprouty2/B-Raf interaction: Sprouty phosphorylation and B-Raf conformation
19545245 No nucleotide change can be detected in any of 26 DNA samples analyzed, with the exception of two already known polymorphic variants, hence any role of the SPRY2 gene in intestinal neuronal dysplasia pathogenesis can be excluded.
19545245 Observational study of gene-disease association. (HuGE Navigator)
19458088 Data show that Spry2 interacts more strongly with PKCdelta with increasing amounts of PKD1, which indicated that instead of competing with PKD1 for binding with PKCdelta, it was more likely to form a trimeric complex with both PKCdelta and PKD1.
19364817 confluent p38alpha-deficient cells fail to downregulate Spry2, providing them in turn with sustained EGFR signaling that facilitates cell overgrowth and oncogenic transformation
19147787 Expression of sprouty2 inhibits B-cell proliferation and is epigenetically silenced in mouse and human B-cell lymphomas.
19022413 ZIC2, SPRY2, and GPC5 genes are candidate genes suspected to explain the malformations associated with cerebral anomalies in the hypothesis of a contiguous gene syndrome in 13q deletion syndrome
19008219 Spry2 inhibits apoptosis in response to DNA damage by regulating Akt, HDM2, and p53, by a process mediated partly by Rac1
18683950 phosphorylation analysis of human Sprouty2, a regulator of receptor tyrosine kinase signaling: fifteen sites of phosphorylation were identified, 11 of which are novel
18678649 Sprouty 2 is present in the synaptic plasma membrane fraction of crude synaptosomal preparations
18622748 Ablation of Sprouty2 with RNA interference can block the KAI1/CD82-induced suppression of hepatoma cell migration and downregulation of SphK1 expression
18485666 results suggest that activated Spry2 may interfere with c-Cbl-mediated ubiquitination of FGFR3 by sequestering c-Cbl.
18427547 detected that hSpry2 promoter hypermethylation was associated with a significant decrease in the 5-year survival rate in B-cell diffuse lymphoma
18214995 may function as a candidate tumor suppressor for hepatocellular carcinoma development
18070883 endogenous hSPRY2-mediated regulation of apoptosis requires c-Cbl and is manifested by the ability of hSPRY2 to sequester c-Cbl and thereby augment signaling via growth factor receptors
18048363 H-Ras interacts with Spry2-binding partners, c-Cbl and CIN85, in a Spry2-dependent manner.
17693063 Although Spry2 transgenic lines express reduced levels of Spry2, Spry2 transgenic lines completely rescue defective facial and palate development in deletion mutant mice.
17689925 These results are evidence that the Sprouty2 mechanism of ERK inhibition is independent of Grb2 binding.
17510316 Spry2 plays a role as tumor suppressor in NSCLC by antagonizing receptor tyrosine kinase-induced signaling at different levels.
17496316 Trophoblast outgrowth and invasion (part of placental villi sprouting) at the fetal maternal interface is in part under delicate control of FGF 10 and Sprouty 2.
17388787 our results suggest that SPRY2 regulates GDNF-dependent proliferation and differentiation of TGW neuroblastoma cells mediated by RET tyrosine kinase.
17320394 interferes with the trafficking of activated EGFR specifically at the step of progression from early to late endosomes.
17255109 PP2A binding to Sprouty2 and phosphorylation changes are a prerequisite for ERK inhibition downstream of FGFR stimulation
16954433 No hypermethylation was found to accompany down-regulation of SPRY2 in prostate cancer tissues and cell lines.
16877379 the Sprouty/Caveolin-1 interaction modulates signaling in a growth factor- and Sprouty isoform-specific manner
16489004 Spry2 inhibits both extracellular signal-regulated kinase signaling as well as proliferation in hepatocellular carcinoma cell lines, whereas knocking down Spry2 levels in NIH3T3 cells causes mild transformation.
16479008 Mnk1-mediated serine phosphorylation of Spry2 constitutes a regulatory mechanism to extend the temporal range of Spry2 activity.
16371366 SPRY2 mediates its anti-proliferative actions by altering PTEN content and activity
16327884 Observational study of gene-disease association. (HuGE Navigator)
16126775 Detection of Sprouty-2 mRNA and protein in human granulosa-lutein cells may suggest a role for Sprouty-2 during the final stages of follicle maturation and corpus luteum formation.
16000370 This work is the first evidence of a key role for Sprouty-2 in skeletal muscle cells, modulating fibroblast growth factor signaling and allowing terminal myogenic differentiation.
15962011 Sprouty2 acts as an inducible inhibitor of EGFR downregulation by targeting both the Cbl and CIN85 pathways.
15950061 Spry 1, 2 and 3 expression was observed in placental tissue from all three trimesters
15735753 hSPRY2 is a potential tumor suppressor locus in a prostate cancer cell line.
15653567 hSPRY2 inhibits growth and migration of vascular smooth muscle cells, and can decrease neointimal growth after blood vessel injury
15564375 FRS2-dependent SRC activation is required for FGFR-induced phosphorylation of Sprouty and suppression of ERK activity
15351707 SPRY2 mediates its anti-migratory actions by inhibiting Rac1 activation
15313890 Data suggest that SPRY2, an inhibitor of ERK signaling, may be bypassed in melanoma cells either by down-regulation of its expression in WT BRAF cells, or by the presence of the BRAF mutation.
15201220 Sprouty proteins regulate ureteric branching by coordinating reciprocal epithelial Wnt11, mesenchymal Gdnf and stromal Fgf7 signalling during kidney development
15122328 Overexpression of SPRY2 inhibits HGF/SF-mediated cell growth, invasion, migration, and cytokinesis.
12815057 tyrosine phosphorylation "activates" hSpry2 by enhancing its interaction with c-Cbl and this interaction is critical for its physiological function in a signal-specific context
12593796 targeted to the ubiquitin-dependent proteasome pathway by c-Cbl
12414790 Data show that an increase in soluble protein-tyrosine phosphatase 1B activity contributes to the anti-migratory, but not anti-mitogenic, actions of human Sprouty 2.
12402043 Spry1 and Spry2 function in a negative feedback mechanism in which the inhibitor activity is controlled rapidly and reversibly by post-translational mechanisms
12391162 Targeting of human Sprouty2 to PtdIns(4,5)P(2) was shown to be essential for the down-regulation of Ras/MAPK signaling.
12234920 Data show that human sprouty2 potentiates epidermal growth factor receptor signalling by specifically intercepting c-Cbl-mediated effects on receptor down-regulation.
11983899 The bimodal regulation of epidermal growth factor signaling by human Sprouty proteins

AA Sequence

MEARAQSGNGSQPLLQTPRDGGRQRGEPDPRDALTQQVHVLSLDQIRAIRNTNEYTEGPTVVPRPGLKPA      1 - 70
PRPSTQHKHERLHGLPEHRQPPRLQHSQVHSSARAPLSRSISTVSSGSRSSTRTSTSSSSSEQRLLGSSF     71 - 140
SSGPVADGIIRVQPKSELKPGELKPLSKEDLGLHAYRCEDCGKCKCKECTYPRPLPSDWICDKQCLCSAQ    141 - 210
NVIDYGTCVCCVKGLFYHCSNDDEDNCADNPCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQ    211 - 280
GCYDRVNRPGCRCKNSNTVCCKVPTVPPRNFEKPT                                       281 - 315
//

Text Mined References (133)

PMID Year Title
26286024 2015 The transcription cofactor c-JUN mediates phenotype switching and BRAF inhibitor resistance in melanoma.
26265114 2015 Sprouty2 suppresses the inflammatory responses in rheumatoid arthritis fibroblast-like synoviocytes through regulating the Raf/ERK and PTEN/AKT signals.
26075267 2015 Cosuppression of Sprouty and Sprouty-related negative regulators of FGF signalling in prostate cancer: a working hypothesis.
26026961 2015 Nickel may contribute to EGFR mutation and synergistically promotes tumor invasion in EGFR-mutated lung cancer via nickel-induced microRNA-21 expression.
25934697 2015 Sprouty2 Drives Drug Resistance and Proliferation in Glioblastoma.
25782674 2015 A SPRY2 mutation leading to MAPK/ERK pathway inhibition is associated with an autosomal dominant form of IgA nephropathy.
25633921 2015 Correlation between microRNA?21 and sprouty homolog 2 gene expression in multiple myeloma.
25630587 2015 Sprouty 2 protein, but not Sprouty 4, is an independent prognostic biomarker for human epithelial ovarian cancer.
25533808 2015 Loss of Sprouty2 in human high-grade serous ovarian carcinomas promotes EGF-induced E-cadherin down-regulation and cell invasion.
25416956 2014 A proteome-scale map of the human interactome network.
25339627 2015 Association between NOGGIN and SPRY2 polymorphisms and nonsyndromic cleft lip with or without cleft palate.
24969401 2014 Placental sprouty 2 (SPRY2): relation to placental growth and maternal metabolic status.
24796743 2014 [Over-expression of human SPRY2 promotes the proliferation and survival of HEK293T cells].
24792382 2014 Genome-wide association study identifies ALLC polymorphisms correlated with FEV? change by corticosteroid.
24554542 2014 Identification of genetic risk factors for maxillary lateral incisor agenesis.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24469046 2015 Casein kinase 1 regulates Sprouty2 in FGF-ERK signaling.
24445374 2014 Differential parsing of EGFR endocytic flux among parallel internalization pathways in lung cancer cells with EGFR-activating mutations.
24292711 2014 Sprouty-2 regulates HIV-specific T cell polyfunctionality.
24094449 2013 Clinical and therapeutic implications of Sprouty2 feedback dysregulation in BRAF V600E-mutation-positive papillary thyroid cancer.
23868981 2013 Regulation of EGFR trafficking and cell signaling by Sprouty2 and MIG6 in lung cancer cells.
23831057 2013 Sprouty2 but not Sprouty4 is a potent inhibitor of cell proliferation and migration of osteosarcoma cells.
23688375 2013 Sprouty2 is associated with prognosis and suppresses cell proliferation and invasion in renal cell carcinoma.
23650389 2013 Cross-talk between MET and EGFR in non-small cell lung cancer involves miR-27a and Sprouty2.
23649631 2013 c-MYC-regulated miR-23a/24-2/27a cluster promotes mammary carcinoma cell invasion and hepatic metastasis by targeting Sprouty2.
23624922 2014 SPROUTY2 is a ?-catenin and FOXO3a target gene indicative of poor prognosis in colon cancer.
23573284 2013 Expression and functional role of sprouty-2 in breast morphogenesis.
23434594 2013 Sprouty2, PTEN, and PP2A interact to regulate prostate cancer progression.
23239100 2013 miR-21 modulates the ERK-MAPK signaling pathway by regulating SPRY2 expression during human mesenchymal stem cell differentiation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23074222 2012 Sprouty proteins are negative regulators of interferon (IFN) signaling and IFN-inducible biological responses.
22863734 2012 Genome-wide meta-analyses of nonsyndromic cleft lip with or without cleft palate identify six new risk loci.
22649008 2012 SPRY2 loss enhances ErbB trafficking and PI3K/AKT signalling to drive human and mouse prostate carcinogenesis.
22581228 2012 A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance.
22383529 2012 G Protein-regulated inducer of neurite outgrowth (GRIN) modulates Sprouty protein repression of mitogen-activated protein kinase (MAPK) activation by growth factor stimulation.
22158968 2012 Intersectin 1 enhances Cbl ubiquitylation of epidermal growth factor receptor through regulation of Sprouty2-Cbl interaction.
22006925 2011 Regulation of cellular levels of Sprouty2 protein by prolyl hydroxylase domain and von Hippel-Lindau proteins.
21909839 2011 Genetic variants at CDC123/CAMK1D and SPRY2 are associated with susceptibility to type 2 diabetes in the Japanese population.
21909357 2011 Sprouty 2 is an independent prognostic factor in breast cancer and may be useful in stratifying patients for trastuzumab therapy.
21784977 2011 Zinc finger protein tristetraprolin interacts with CCL3 mRNA and regulates tissue inflammation.
21762810 2011 Sprouty2 regulates PI(4,5)P2/Ca2+ signaling and HIV-1 Gag release.
21706003 2011 Genetic variation near IRS1 associates with reduced adiposity and an impaired metabolic profile.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21364986 2011 Sprouty2 and Spred1-2 proteins inhibit the activation of the ERK pathway elicited by cyclopentenone prostanoids.
21288888 2011 Cleavage-site specificity of prolyl endopeptidase FAP investigated with a full-length protein substrate.
21278789 2011 Downregulation of Spry2 by miR-21 triggers malignancy in human gliomas.
21239886 The elusive role of the SPRY2 domain in RyR1.
21134562 2010 Spry2 expression correlates with BRAF mutation in thyroid cancer.
21111454 2011 Promoter hypermethylation and expression of sprouty 2 in endometrial carcinoma.
21099344 2011 Deregulated expression of sprouty2 and microRNA-21 in human colon cancer: Correlation with the clinical stage of the disease.
20956544 2011 ErbB2 stabilizes epidermal growth factor receptor (EGFR) expression via Erk and Sprouty2 in extracellular matrix-detached cells.
20934684 2011 Early proliferation alteration and differential gene expression in human periodontal ligament cells subjected to cyclic tensile stress.
20877636 2010 Additional serine/threonine phosphorylation reduces binding affinity but preserves interface topography of substrate proteins to the c-Cbl TKB domain.
20862305 2010 Identification of new genetic risk variants for type 2 diabetes.
20736167 2010 Direct association of Sprouty-related protein with an EVH1 domain (SPRED) 1 or SPRED2 with DYRK1A modifies substrate/kinase interactions.
20678191 2010 Functional interaction between Env oncogene from Jaagsiekte sheep retrovirus and tumor suppressor Sprouty2.
20661223 2010 Sprouty-2 controls c-Met expression and metastatic potential of colon cancer cells: sprouty/c-Met upregulation in human colonic adenocarcinomas.
20638779 2010 miR-27a regulates the growth, colony formation and migration of pancreatic cancer cells by targeting Sprouty2.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20624167 2010 Sprouty2 protein enhances the response to gefitinib through epidermal growth factor receptor in colon cancer cells.
20572854 2010 MTHFR and MSX1 contribute to the risk of nonsyndromic cleft lip/palate.
20543868 2010 SPROUTY-2 and E-cadherin regulate reciprocally and dictate colon cancer cell tumourigenicity.
20237272 2010 Repression of Fgf signaling by sprouty1-2 regulates cortical patterning in two distinct regions and times.
20123980 2010 Establishment of extracellular signal-regulated kinase 1/2 bistability and sustained activation through Sprouty 2 and its relevance for epithelial function.
20023658 2010 Genome-wide association study identifies two susceptibility loci for nonsyndromic cleft lip with or without cleft palate.
19864419 2010 HECT domain-containing E3 ubiquitin ligase Nedd4 interacts with and ubiquitinates Sprouty2.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19690147 2009 Sprouty2 association with B-Raf is regulated by phosphorylation and kinase conformation.
19545245 2009 Search for pathogenetic variants of the SPRY2 gene in intestinal innervation defects.
19458088 2009 Sprouty2 interacts with protein kinase C delta and disrupts phosphorylation of protein kinase D1.
19364817 2009 Cell density-dependent inhibition of epidermal growth factor receptor signaling by p38alpha mitogen-activated protein kinase via Sprouty2 downregulation.
19147787 2009 Expression of sprouty2 inhibits B-cell proliferation and is epigenetically silenced in mouse and human B-cell lymphomas.
19022413 Twelve new patients with 13q deletion syndrome: genotype-phenotype analyses in progress.
19008219 2009 Sprouty 2 regulates DNA damage-induced apoptosis in Ras-transformed human fibroblasts.
18683950 2008 Targeted online liquid chromatography electron capture dissociation mass spectrometry for the localization of sites of in vivo phosphorylation in human Sprouty2.
18678649 2008 Sprouty2-mediated inhibition of fibroblast growth factor signaling is modulated by the protein kinase DYRK1A.
18622748 2008 KAI1/CD82 suppresses hepatocyte growth factor-induced migration of hepatoma cells via upregulation of Sprouty2.
18485666 2008 Sprouty 2 disturbs FGFR3 degradation in thanatophoric dysplasia type II: a severe form of human achondroplasia.
18427547 2008 Epigenetic inactivation of the ERK inhibitor Spry2 in B-cell diffuse lymphomas.
18273061 2008 Structural basis for a novel intrapeptidyl H-bond and reverse binding of c-Cbl-TKB domain substrates.
18214995 2008 Integration of genomic analysis and in vivo transfection to identify sprouty 2 as a candidate tumor suppressor in liver cancer.
18070883 2008 A novel role of Sprouty 2 in regulating cellular apoptosis.
18048363 2008 Evidence that sprouty 2 is necessary for sarcoma formation by H-Ras oncogene-transformed human fibroblasts.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17693063 A dosage-dependent role for Spry2 in growth and patterning during palate development.
17689925 2007 Sprouty2 binds Grb2 at two different proline-rich regions, and the mechanism of ERK inhibition is independent of this interaction.
17510316 2007 Down-regulation of Sprouty2 in non-small cell lung cancer contributes to tumor malignancy via extracellular signal-regulated kinase pathway-dependent and -independent mechanisms.
17496316 2007 FGF 10 and Sprouty 2 modulate trophoblast invasion and branching morphogenesis.
17388787 2007 Sprouty2 regulates growth and differentiation of human neuroblastoma cells through RET tyrosine kinase.
17320394 2007 Spatial regulation of EGFR signaling by Sprouty2.
17255109 2007 Direct binding of PP2A to Sprouty2 and phosphorylation changes are a prerequisite for ERK inhibition downstream of fibroblast growth factor receptor stimulation.
16954433 2006 Concomitant down-regulation of SPRY1 and SPRY2 in prostate carcinoma.
16893902 2006 A Src homology 3-binding sequence on the C terminus of Sprouty2 is necessary for inhibition of the Ras/ERK pathway downstream of fibroblast growth factor receptor stimulation.
16877379 2006 A functional interaction between sprouty proteins and caveolin-1.
16489004 2006 Sprouty 2, an inhibitor of mitogen-activated protein kinase signaling, is down-regulated in hepatocellular carcinoma.
16479008 2006 Regulation of sprouty stability by Mnk1-dependent phosphorylation.
16381901 2006 The LIFEdb database in 2006.
16371366 2006 The tumor suppressor PTEN is necessary for human Sprouty 2-mediated inhibition of cell proliferation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16327884 2005 Medical sequencing of candidate genes for nonsyndromic cleft lip and palate.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16126775 2005 Expression and regulation of Sprouty-2 in the granulosa-lutein cells of the corpus luteum.
16000370 2005 Sprouty-2 overexpression in C2C12 cells confers myogenic differentiation properties in the presence of FGF2.
15962011 2005 Sprouty2 acts at the Cbl/CIN85 interface to inhibit epidermal growth factor receptor downregulation.
15950061 2005 Human placental Hofbauer cells express sprouty proteins: a possible modulating mechanism of villous branching.
15735753 2005 Epigenetic inactivation of the human sprouty2 (hSPRY2) homologue in prostate cancer.
15653567 2005 Regulation of vascular smooth muscle cell proliferation and migration by human sprouty 2.
15564375 2004 FRS2-dependent SRC activation is required for fibroblast growth factor receptor-induced phosphorylation of Sprouty and suppression of ERK activity.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15351707 2004 Sprouty regulates cell migration by inhibiting the activation of Rac1 GTPase.
15313890 2004 SPRY2 is an inhibitor of the ras/extracellular signal-regulated kinase pathway in melanocytes and melanoma cells with wild-type BRAF but not with the V599E mutant.
15201220 2004 Sprouty proteins regulate ureteric branching by coordinating reciprocal epithelial Wnt11, mesenchymal Gdnf and stromal Fgf7 signalling during kidney development.
15122328 2004 Overexpression of sprouty 2 inhibits HGF/SF-mediated cell growth, invasion, migration, and cytokinesis.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
15031289 2004 Shp2, an SH2-containing protein-tyrosine phosphatase, positively regulates receptor tyrosine kinase signaling by dephosphorylating and inactivating the inhibitor Sprouty.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12815057 2003 Tyrosine phosphorylation of Sprouty2 enhances its interaction with c-Cbl and is crucial for its function.
12717443 2003 Mammalian Sprouty4 suppresses Ras-independent ERK activation by binding to Raf1.
12593796 2003 hSpry2 is targeted to the ubiquitin-dependent proteasome pathway by c-Cbl.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414790 2003 Protein-tyrosine phosphatase-1B (PTP1B) mediates the anti-migratory actions of Sprouty.
12402043 2002 Sprouty1 and Sprouty2 provide a control mechanism for the Ras/MAPK signalling pathway.
12391162 2002 The cysteine-rich sprouty translocation domain targets mitogen-activated protein kinase inhibitory proteins to phosphatidylinositol 4,5-bisphosphate in plasma membranes.
12234920 2002 Sprouty2 attenuates epidermal growth factor receptor ubiquitylation and endocytosis, and consequently enhances Ras/ERK signalling.
11983899 2002 The bimodal regulation of epidermal growth factor signaling by human Sprouty proteins.
11698404 2002 Sprouty2 inhibits the Ras/MAP kinase pathway by inhibiting the activation of Raf.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11053437 2001 Evidence for direct interaction between Sprouty and Cbl.
10940627 2000 Human SPRY2 inhibits FGF2 signalling by a secreted factor.
10887178 2000 Sprouty proteins are targeted to membrane ruffles upon growth factor receptor tyrosine kinase activation. Identification of a novel translocation domain.
9458049 1998 sprouty encodes a novel antagonist of FGF signaling that patterns apical branching of the Drosophila airways.