Property Summary

NCBI Gene PubMed Count 44
PubMed Score 130.99
PubTator Score 32.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Rheumatoid Arthritis 2.700 2.2e-02
malignant mesothelioma -3.400 5.7e-09
psoriasis -1.900 6.0e-05
glioblastoma 2.300 3.0e-04
atypical teratoid/rhabdoid tumor 2.400 1.2e-07
adrenocortical carcinoma -1.030 1.9e-02
tuberculosis -1.400 8.5e-04
intraductal papillary-mucinous adenoma (... -1.300 2.8e-02
intraductal papillary-mucinous carcinoma... -1.200 3.4e-02
pediatric high grade glioma 2.000 5.5e-06
pilocytic astrocytoma 1.700 1.5e-06
non-inflammatory breast cancer -1.800 6.5e-06
breast carcinoma -1.100 6.4e-22
ovarian cancer 2.500 8.3e-06

Synonym

Accession O43609 D3DNX6 Q6PNE0 Spry-1
Symbols hSPRY1

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (11)

Gene RIF (29)

PMID Text
26526994 Suppression of SPRY1 by age-associated methylation inhibits the replenishment of the muscle stem cell pool.
26075267 Cosuppression of Sprouty and Sprouty-related negative regulators of FGF signalling in prostate cancer
24932220 There is an inverse correlation between the expression of Spry1 and growth, proliferation, invasion and migration of ovarian cancer cells.
24604720 A random population of LNCaP prostate cancer cells comprises a heterogeneous group of cells with different androgen-deprivation sensitivities and potential for invasiveness; expression levels of 2 genes known to be regulated by miR-21, an androgen-regulated microRNA, SPRY1 and JAG1 were lower in an androgen insensitive clone, than an androgen sensitive clone.
24270409 The Spry1 acts as a sensor of mitogenic activity that not only attenuates RTK signaling but also induces a cellular senescence response to avoid uncontrolled proliferation.
23616430 Sprouty1 expression is not connected with mitogenic signaling and cell proliferation.
23554919 Spry1 and Spry4 have opposing roles in VSMC phenotypic modulation, and Spry1 maintains the VSMC differentiation phenotype in vitro in part through an Akt/FoxO/myocardin pathway.
23527175 Re-expression of SPRY1, a repressed target of BCL11B, limits the transformation capacity of Ewing sarcoma cells.
23469214 Feedback regulations of miR-21 and MAPKs via Pdcd4 and Spry1 are involved in arsenite-induced cell malignant transformation.
23441172 miR-21 promotes robust fibrogenic EMT of EMCs, in part by directly targeting PDCD4 and SPRY1.
23333304 HIV-1 Vif upregulates the expression of sprouty homolog 1 protein (SPRY1, antagonist of FGF signaling) in Vif-expression T cells
23146288 Results suggest that the SPRY1 gene is an important genetic factor for determining the risk of both obesity and osteoporosis in humans.
23074222 siRNA-mediated knockdown of Spry1, Spry2, or Spry4 promotes IFN-inducible antileukemic effects in vitro and results in enhanced suppressive effects on malignant hematopoietic progenitors from patients with polycythemia vera.
22880013 The spatio-temporal expression of Decorin, Semaphorin6D, SPARC, Spry-1 and Tsukushi in developing prostate is described and observed similar mesenchymal expression patterns in rat and human.
21826097 Spry1 is a target for miR-21-mediated gene silencing.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20813052 Results suggest that SPRY1 is an endogenous angiogenesis inhibitor.
20696135 hSpry1 and HAX1 proteins are putative candidate proteins that interact with uPAR.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20237272 Sprouty1 and Sprouty2 effect cortical cell proliferation, differentiation, and the expression of genes regulating progenitor identity in the ventricular zone.
20068162 SPRY1 supported formation of activated ERK and mitogen-activated protein/ERK kinase and was essential for ERMS cell proliferation and survivalin rhabdomyosarcoma.
20054616 Data show that upregulation of Spry1 in HUVECs inhibits tube formation and is associated with decreased proliferation and increased expression of p21 and p27.
19915061 Sprouty1 induced by TCR signal negatively regulates further TCR signaling by interacting with proximal signaling molecules in immune synapse, providing a novel regulatory mechanism of T cells.
19164898 DNA methylation in the Sprouty1 promoter region is responsible for downregulating Sprouty1 expression in prostate cancer
16954433 Expression of an SPRY1 alternative transcript is presumed to be specific for fetal tissues and and is moderately expressd in prostate csncer tissues and cell lines.
16877379 the Sprouty/Caveolin-1 interaction modulates signaling in a growth factor- and Sprouty isoform-specific manner
15950061 Spry 1, 2 and 3 expression was observed in placental tissue from all three trimesters
14533010 Expression analysis of SPRY1a and SPRY1b shows that they are hardly expressed in adult human, but have different expression patterns in fetus, which confirmed that SPRY1 is an important gene during fetal development
11983899 The bimodal regulation of epidermal growth factor signaling by human Sprouty proteins

AA Sequence

MDPQNQHGSGSSLVVIQQPSLDSRQRLDYEREIQPTAILSLDQIKAIRGSNEYTEGPSVVKRPAPRTAPR      1 - 70
QEKHERTHEIIPINVNNNYEHRHTSHLGHAVLPSNARGPILSRSTSTGSAASSGSNSSASSEQGLLGRSP     71 - 140
PTRPVPGHRSERAIRTQPKQLIVDDLKGSLKEDLTQHKFICEQCGKCKCGECTAPRTLPSCLACNRQCLC    141 - 210
SAESMVEYGTCMCLVKGIFYHCSNDDEGDSYSDNPCSCSQSHCCSRYLCMGAMSLFLPCLLCYPPAKGCL    211 - 280
KLCRRCYDWIHRPGCRCKNSNTVYCKLESCPSRGQGKPS                                   281 - 319
//

Text Mined References (45)

PMID Year Title
26526994 2015 Age-Associated Methylation Suppresses SPRY1, Leading to a Failure of Re-quiescence and Loss of the Reserve Stem Cell Pool in Elderly Muscle.
26075267 2015 Cosuppression of Sprouty and Sprouty-related negative regulators of FGF signalling in prostate cancer: a working hypothesis.
25416956 2014 A proteome-scale map of the human interactome network.
24932220 2014 The expression of the Sprouty 1 protein inversely correlates with growth, proliferation, migration and invasion of ovarian cancer cells.
24797007 2014 Genome-wide association study identifies two novel genomic regions in irritable bowel syndrome.
24604720 2014 Correlation of Sprouty1 and Jagged1 with aggressive prostate cancer cells with different sensitivities to androgen deprivation.
24270409 2014 Sprouty1 induces a senescence-associated secretory phenotype by regulating NF?B activity: implications for tumorigenesis.
23616430 2014 In non-small cell lung cancer mitogenic signaling leaves Sprouty1 protein levels unaffected.
23554919 2013 Spry1 and Spry4 differentially regulate human aortic smooth muscle cell phenotype via Akt/FoxO/myocardin signaling.
23527175 2013 BCL11B is up-regulated by EWS/FLI and contributes to the transformed phenotype in Ewing sarcoma.
23469214 2013 Feedback regulations of miR-21 and MAPKs via Pdcd4 and Spry1 are involved in arsenite-induced cell malignant transformation.
23441172 2013 miR-21 promotes fibrogenic epithelial-to-mesenchymal transition of epicardial mesothelial cells involving Programmed Cell Death 4 and Sprouty-1.
23146288 2013 Association between the SPRY1 gene polymorphism and obesity-related traits and osteoporosis in Korean women.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
23074222 2012 Sprouty proteins are negative regulators of interferon (IFN) signaling and IFN-inducible biological responses.
22880013 2012 Stromal expression of decorin, Semaphorin6D, SPARC, Sprouty1 and Tsukushi in developing prostate and decreased levels of decorin in prostate cancer.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21826097 2011 Transcriptional and post-transcriptional regulation of Sprouty1, a receptor tyrosine kinase inhibitor in prostate cancer.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20813052 2010 Sprouty1, a new target of the angiostatic agent 16K prolactin, negatively regulates angiogenesis.
20696135 2010 Novel protein interactors of urokinase-type plasminogen activator receptor.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20237272 2010 Repression of Fgf signaling by sprouty1-2 regulates cortical patterning in two distinct regions and times.
20068162 2010 Silencing of SPRY1 triggers complete regression of rhabdomyosarcoma tumors carrying a mutated RAS gene.
20054616 2010 Sprouty1 inhibits angiogenesis in association with up-regulation of p21 and p27.
19915061 2009 Recruitment of Sprouty1 to immune synapse regulates T cell receptor signaling.
19164898 2009 DNA methylation and aberrant expression of Sprouty1 in human prostate cancer.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16954433 2006 Concomitant down-regulation of SPRY1 and SPRY2 in prostate carcinoma.
16877379 2006 A functional interaction between sprouty proteins and caveolin-1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15962011 2005 Sprouty2 acts at the Cbl/CIN85 interface to inhibit epidermal growth factor receptor downregulation.
15950061 2005 Human placental Hofbauer cells express sprouty proteins: a possible modulating mechanism of villous branching.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14533010 2003 Identification and expression analysis of a novel splice variant of human Sprouty1 gene.
12869526 2003 HCC-associated protein HCAP1, a variant of GEMIN4, interacts with zinc-finger proteins.
12593796 2003 hSpry2 is targeted to the ubiquitin-dependent proteasome pathway by c-Cbl.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12402043 2002 Sprouty1 and Sprouty2 provide a control mechanism for the Ras/MAPK signalling pathway.
11983899 2002 The bimodal regulation of epidermal growth factor signaling by human Sprouty proteins.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
10887178 2000 Sprouty proteins are targeted to membrane ruffles upon growth factor receptor tyrosine kinase activation. Identification of a novel translocation domain.
9458049 1998 sprouty encodes a novel antagonist of FGF signaling that patterns apical branching of the Drosophila airways.