Property Summary

NCBI Gene PubMed Count 35
PubMed Score 50.12
PubTator Score 27.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
esophageal adenocarcinoma -4.400 2.4e-02
psoriasis 7.000 2.1e-123
cutaneous lupus erythematosus 3.500 3.3e-03
non-small cell lung cancer 4.362 2.5e-10
intraductal papillary-mucinous neoplasm ... 2.100 8.5e-03
colon cancer 1.400 2.7e-03
pancreatic cancer 2.300 4.0e-03
lung cancer -4.900 1.8e-02
cystic fibrosis 4.700 7.1e-05
nasopharyngeal carcinoma -3.400 1.2e-04

Gene RIF (12)

PMID Text
23820115 Results implicate that SPRR3 might serve as a radiation-sensitive predictor of ESCC.
22076481 This study demonstrates that SPRR3 promotes BC cell proliferation by enhancing p53 degradation via the AKT and MAPK pathways
21777580 The quantitative analysis of SPRR3 mRNA is a robust and reliable method to monitor the malignant transformation of the healthy esophageal mucosa into esophageal squamous cell carcinoma.
21490620 The SPRR3 variant associated with eczema carried an extra 24-bp repeat in the central domain, which may alter the physical properties of the cornified cell envelope
20599699 two isoforms of SPRR3 were characterized from saliva of preterm human newborn and autoptic fetal oral mucosa, parotid and submandibular gland samples.
20379613 Results suggest that increased expression of SPRR3 is involved in colorectal tumorigenesis.
19211270 Sciellin, SPRR3, and periplakin transcripts were all upregulated (4.67-, 4.95-, 2.77-fold, respectively) by prolonged exposure to cyclic strain (24-72 h), but not at earlier time points.
18832573 These data suggest that SPRR3 may play a role in vascular smooth muscle cells adaptation to local biomechanical stress within the plaque microenvironment.
18643845 Association of psoriasis to PGLYRP and SPRR genes at PSORS4 locus on 1q shows heterogeneity between Finnish, Swedish and Irish families.
17935133 Esophagin/SPRR3 may play a role in the maintenance of normal esophageal epithelial homeostasis, and aberrant expression of Esophagin/SPRR3 may contribute to the tumorigenesis of esophageal squamous cell carcinoma
15221970 A marker of human esophageal neoplastic progression
14748073 SPR3 transcripts were significantly increased in human papillomavirus 11-infected tissues and minimally increased in human papillomavirus 59-infected tissues

AA Sequence

MSSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVP      1 - 70
EPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTK     71 - 140
VPVPGYTKLPEPCPSTVTPGPAQQKTKQK                                             141 - 169
//

Text Mined References (37)

PMID Year Title
23820115 2013 Small proline-rich repeat protein 3 enhances the sensitivity of esophageal cancer cells in response to DNA damage-induced apoptosis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22076481 2012 Expression of SPRR3 is associated with tumor cell proliferation in less advanced stages of breast cancer.
21777580 2011 Quantitative evaluation of SPRR3 expression in esophageal squamous cell carcinoma by qPCR and its potential use as a biomarker.
21490620 2011 Association screening in the Epidermal Differentiation Complex (EDC) identifies an SPRR3 repeat number variant as a risk factor for eczema.
20599699 2010 Characterization of two isoforms of human SPRR3 from saliva of preterm human newborn and autoptic fetal oral mucosa, parotid and submandibular gland samples.
20379613 Upregulation of SPRR3 promotes colorectal tumorigenesis.
19211270 Biomechanical stress induces novel arterial intima-enriched genes: implications for vascular adaptation to stress.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18832573 2008 Regulation of the atheroma-enriched protein, SPRR3, in vascular smooth muscle cells through cyclic strain is dependent on integrin alpha1beta1/collagen interaction.
18643845 2009 Association of psoriasis to PGLYRP and SPRR genes at PSORS4 locus on 1q shows heterogeneity between Finnish, Swedish and Irish families.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17935133 2008 Exogenous expression of Esophagin/SPRR3 attenuates the tumorigenicity of esophageal squamous cell carcinoma cells via promoting apoptosis.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15232223 2004 Estrogen regulates the expression of the small proline-rich 2 gene family in the mouse uterus.
15221970 2004 Esophagin and proliferating cell nuclear antigen (PCNA) are biomarkers of human esophageal neoplastic progression.
14761935 2004 Differential gene expression profile of human tonsil high endothelial cells: implications for lymphocyte trafficking.
14748073 2004 Infection with Human Papillomavirus alters expression of the small proline rich proteins 2 and 3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12786819 2003 Differential expression of cornified cell envelope precursors in normal skin, intraorally transplanted skin and normal oral mucosa.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12036303 2002 Activation of the esophagin promoter during esophageal epithelial cell differentiation.
11443109 2001 Transglutaminase 5 cross-links loricrin, involucrin, and small proline-rich proteins in vitro.
11279051 2001 Structural organization and regulation of the small proline-rich family of cornified envelope precursors suggest a role in adaptive barrier function.
11230159 2001 Identification of human epidermal differentiation complex (EDC)-encoded genes by subtractive hybridization of entire YACs to a gridded keratinocyte cDNA library.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10510474 1999 Transglutaminase crosslinking and structural studies of the human small proline rich 3 protein.
9889002 1999 Structure and evolution of the human SPRR3 gene: implications for function and regulation.
9724607 1998 Small proline-rich proteins are cross-bridging proteins in the cornified cell envelopes of stratified squamous epithelia.
8999895 1997 Direct evidence that involucrin is a major early isopeptide cross-linked component of the keratinocyte cornified cell envelope.
8809402 1996 Esophagin cDNA cloning and characterization: a tissue-specific member of the small proline-rich protein family that is not expressed in esophageal tumors.
8325635 1993 Molecular characterization and evolution of the SPRR family of keratinocyte differentiation markers encoding small proline-rich proteins.
8018055 1994 Differential expression of protease inhibitor and small proline-rich protein genes between normal human oral tissue and odontogenic keratocysts.
7829876 1995 The pancornulins: a group of small proline rich-related cornified envelope precursors with bifunctional capabilities in isopeptide bond formation.