Property Summary

NCBI Gene PubMed Count 21
PubMed Score 26.70
PubTator Score 22.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
esophageal adenocarcinoma -4.900 2.2e-02
psoriasis 3.600 1.6e-177
cutaneous lupus erythematosus 1.600 1.8e-03
non-small cell lung cancer 5.245 3.0e-14
intraductal papillary-mucinous neoplasm ... 3.100 1.7e-02
pancreatic cancer 2.300 4.1e-03
lung cancer -5.000 6.8e-03
cystic fibrosis 1.900 3.9e-04
nasopharyngeal carcinoma -2.400 1.1e-02
ulcerative colitis 2.400 2.5e-02

Synonym

Accession P22528 B2R5H7 P22529 P22530 Q5T524
Symbols SPRR1
GADD33
SPR-IB
CORNIFIN

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

PMID Text
23954638 expression of SPRR1B is upregulated in oral CSCs/CICs and SPRR1B has a role in cell growth by suppression of RASSF4
19601998 Observational study of gene-disease association. (HuGE Navigator)
18643845 Association of psoriasis to PGLYRP and SPRR genes at PSORS4 locus on 1q shows heterogeneity between Finnish, Swedish and Irish families.
18172072 SPRR1B is a valid biomarker for the study of the molecular mechanisms of squamous metaplasia. There is a definitive link between inflammation and squamous metaplasia in autoimmune-mediated dry eye disease
12832281 SPRR1B expression pattern in nonsquamous tumors; findings indicate SPRR1B likely coupled to signals responsible for withdrawal from the proliferative state; overexpression for prolonged periods may disrupt normal progression of mitosis
12091247 BMK1 (ERK5) regulates squamous differentiation marker SPRR1B transcription in Clara-like H441 cells.

AA Sequence

MSSQQQKQPCTPPPQLQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCHPKVP      1 - 70
EPCPSIVTPAPAQQKTKQK                                                        71 - 89
//

Text Mined References (22)

PMID Year Title
23954638 2013 Small proline-rich protein-1B is overexpressed in human oral squamous cell cancer stem-like cells and is related to their growth through activation of MAP kinase signal.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
19601998 2009 Variation in genes of the epidermal differentiation complex in German atopic dermatitis patients.
18643845 2009 Association of psoriasis to PGLYRP and SPRR genes at PSORS4 locus on 1q shows heterogeneity between Finnish, Swedish and Irish families.
18172072 2008 Small proline-rich protein 1B (SPRR1B) is a biomarker for squamous metaplasia in dry eye disease.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12832281 2003 SPRR1B overexpression enhances entry of cells into the G0 phase of the cell cycle.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12091247 2002 BMK1 (ERK5) regulates squamous differentiation marker SPRR1B transcription in Clara-like H441 cells.
10908733 2000 Small proline-rich protein 1 is the major component of the cell envelope of normal human oral keratinocytes.
9115270 1997 S100A11, S100A10, annexin I, desmosomal proteins, small proline-rich proteins, plasminogen activator inhibitor-2, and involucrin are components of the cornified envelope of cultured human epidermal keratinocytes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8631988 1996 Cloning and regulation of cornifin beta, a new member of the cornifin/spr family. Suppression by retinoic acid receptor-selective retinoids.
8388378 1993 Isolation and characterization of the human spr1 gene and its regulation of expression by phorbol ester and cyclic AMP.
8325635 1993 Molecular characterization and evolution of the SPRR family of keratinocyte differentiation markers encoding small proline-rich proteins.
7829876 1995 The pancornulins: a group of small proline rich-related cornified envelope precursors with bifunctional capabilities in isopeptide bond formation.
3133554 1988 Isolation, characterization, and UV-stimulated expression of two families of genes encoding polypeptides of related structure in human epidermal keratinocytes.
1627333 1992 An unusual expression of a squamous cell marker, small proline-rich protein gene, in tracheobronchial epithelium: differential regulation and gene mapping.
1482123 1992 Mammalian genes induced by radiation; activation of genes associated with growth control.
1438308 1992 Cornifin, a cross-linked envelope precursor in keratinocytes that is down-regulated by retinoids.