Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.77
PubTator Score 5.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 4.3e-08
medulloblastoma, large-cell 6241 7.3e-03

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell -1.100 7.3e-03
ovarian cancer -1.400 4.3e-08

Gene RIF (2)

AA Sequence

MVRVRAVVMARDDSSGGWLPVGGGGLSQVSVCRVRGARPEGGARQGHYVIHGERLRDQKTTLECTLKPGL      1 - 70
VYNKVNPIFHHWSLGDCKFGLTFQSPAEADEFQKSLLAALAALGRGSLTPSSSSSSSSPSQDTAETPCPL     71 - 140
TSHVDSDSSSSHSRQETPPSAAAAPIITMESASGFGPTTPPQRRRSSAQSYPPLLPFTGIPEPSEPLAGA    141 - 210
GGLGWGGRGYEDYRRSGPPAPLALSTCVVRFAKTGALRGAALGPPAALPAPLTEAAPPAPPARPPPGPGP    211 - 280
SSAPAKASPEAEEAARCVHCRALFRRRADGRGGRCAEAPDPGRLLVRRLSCLWCAESLLYHCLSDAEGDF    281 - 350
SDPCACEPGHPRPAARWAALAALSLAVPCLCCYAPLRACHWVAARCGCAGCGGRHEEAAR              351 - 410
//

Text Mined References (8)

PMID Year Title