Property Summary

NCBI Gene PubMed Count 53
PubMed Score 79.11
PubTator Score 50.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Bipolar Disorder 666 0.0 1.1
Disease Target Count
Neurofibromatosis, Type 1 5

Expression

  Differential Expression (20)

Disease log2 FC p
active ulcerative colitis 1.078 3.4e-02
acute myeloid leukemia -2.000 2.2e-02
aldosterone-producing adenoma -1.211 9.4e-03
astrocytic glioma -1.500 1.9e-03
Astrocytoma, Pilocytic 1.800 4.4e-06
atypical teratoid / rhabdoid tumor 1.900 2.8e-03
Breast cancer 3.900 4.0e-02
ependymoma -1.100 4.0e-02
gastric carcinoma 1.100 8.3e-03
glioblastoma 1.200 5.2e-04
group 3 medulloblastoma -1.500 6.1e-03
intraductal papillary-mucinous adenoma (... 1.200 1.9e-02
lung carcinoma -1.200 9.9e-22
medulloblastoma, large-cell -1.900 1.1e-02
osteosarcoma 1.671 1.1e-02
ovarian cancer -1.900 1.3e-04
pediatric high grade glioma 1.500 7.5e-04
Pick disease -1.200 3.8e-05
Polycystic ovary syndrome -1.021 1.7e-03
tuberculosis and treatment for 3 months 1.200 9.2e-03

Synonym

Accession Q7Z699 B2RPJ8 Q05D53 Q8N256 Spred-1
Symbols NFLS
hSpred1
spred-1
PPP1R147

Gene

PANTHER Protein Class (1)

PDB

3SYX  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 OMIM Phenotype (1)

 GWAS Trait (1)

Gene RIF (34)

AA Sequence

MSEETATSDNDNSYARVRAVVMTRDDSSGGWLPLGGSGLSSVTVFKVPHQEENGCADFFIRGERLRDKMV      1 - 70
VLECMLKKDLIYNKVTPTFHHWKIDDKKFGLTFQSPADARAFDRGIRRAIEDISQGCPESKNEAEGADDL     71 - 140
QANEEDSSSSLVKDHLFQQETVVTSEPYRSSNIRPSPFEDLNARRVYMQSQANQITFGQPGLDIQSRSME    141 - 210
YVQRQISKECGSLKSQNRVPLKSIRHVSFQDEDEIVRINPRDILIRRYADYRHPDMWKNDLERDDADSSI    211 - 280
QFSKPDSKKSDYLYSCGDETKLSSPKDSVVFKTQPSSLKIKKSKRRKEDGERSRCVYCQERFNHEENVRG    281 - 350
KCQDAPDPIKRCIYQVSCMLCAESMLYHCMSDSEGDFSDPCSCDTSDDKFCLRWLALVALSFIVPCMCCY    351 - 420
VPLRMCHRCGEACGCCGGKHKAAG                                                  421 - 444
//

Text Mined References (59)

PMID Year Title