Property Summary

NCBI Gene PubMed Count 17
PubMed Score 21.11
PubTator Score 26.22

Knowledge Summary

Patent

No data available

Gene RIF (8)

AA Sequence

MISRMEKMTMMMKILIMFALGMNYWSCSGFPVYDYDPSSLRDALSASVVKVNSQSLSPYLFRAFRSSLKR      1 - 70
VEVLDENNLVMNLEFSIRETTCRKDSGEDPATCAFQRDYYVSTAVCRSTVKVSAQQVQGVHARCSWSSST     71 - 140
SESYSSEEMIFGDMLGSHKWRNNYLFGLISDESISEQFYDRSLGIMRRVLPPGNRRYPNHRHRARINTDF    141 - 210
E//

Text Mined References (18)

PMID Year Title