Property Summary

NCBI Gene PubMed Count 802
PubMed Score 4598.41
PubTator Score 3127.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (34)

Disease log2 FC p
permanent atrial fibrillation 1.700 3.5e-03
esophageal adenocarcinoma 2.400 1.8e-02
cutaneous lupus erythematosus 3.000 1.2e-02
psoriasis 2.400 5.2e-03
glioblastoma 2.700 2.0e-04
non diabetic and post-ischemic heart fai... -1.900 3.0e-02
Duchenne muscular dystrophy 3.166 6.9e-07
Becker muscular dystrophy 1.667 5.3e-04
limb girdle muscular dystrophy 2B 2.662 7.6e-05
acute quadriplegic myopathy 1.328 2.1e-02
adrenocortical carcinoma 3.731 4.1e-05
tuberculosis -5.400 1.8e-06
primary pancreatic ductal adenocarcinoma 2.157 8.9e-05
non-small cell lung cancer 4.319 2.8e-20
intraductal papillary-mucinous adenoma (... -4.900 5.7e-04
intraductal papillary-mucinous carcinoma... -3.100 3.4e-02
lung cancer 5.900 8.9e-08
sarcoidosis 4.500 4.7e-02
breast carcinoma 2.500 1.1e-16
interstitial cystitis 2.900 2.1e-03
lung adenocarcinoma 4.980 2.4e-17
pediatric high grade glioma 1.700 4.6e-03
pilocytic astrocytoma 1.300 3.1e-02
posterior fossa group A ependymoma 1.200 9.7e-03
invasive ductal carcinoma 4.100 3.1e-04
nasopharyngeal carcinoma 2.300 3.0e-02
Endometriosis -2.306 3.3e-02
Breast cancer -4.400 3.1e-02
gastric carcinoma 4.200 4.1e-02
ductal carcinoma in situ 4.100 8.0e-05
ulcerative colitis 3.700 4.0e-04
ovarian cancer 5.200 8.9e-06
Down syndrome 2.200 1.3e-03
pancreatic cancer 2.200 5.5e-05

Protein-protein Interaction (2)

Gene RIF (769)

PMID Text
26986465 Using plasma samples from hepatocellular carcinoma patients and liver cirrhosis control patients, plasma AFP, PIVKA-II, OPN and DKK-1 levels were measured. The sensitivity and specificity for OPN biomarker was 46.2% and 80.3% (OPN>100 ng/mL).
26840958 Inhibition of Cellular Adhesion by Immunological Targeting of Osteopontin Neoepitopes Generated through Matrix Metalloproteinase and Thrombin Cleavage.
26823725 OPN is constitutively expressed in highly invasive human choriocarcinoma cell lines, promoting neoplasm invasiveness via MMP9.
26821678 fibroblast expression patterns of Tiam1 and osteopontin in human breast cancers show converse changes correlating with invasion, supporting the hypothesis that this pathway in tumor-associated fibroblasts regulates breast cancer invasiveness
26811408 OPN expression is associated with good prognostic features in Medullary thyroid carcinoma.
26731746 OPN can contribute to the impairment of innate host defense by interfering with the function of antimicrobial proteins, thus increasing the vulnerability to acquire infections during COPD.
26701868 Polycystic ovary syndrome is associated with increased OPN levels.
26698858 Low serum osteopontin levels are associated with good response to tocilizumab treatment for Rheumatoid Arthritis.
26656246 SPP1 rs4754 polymorphism may be related to risk of fracture, but not rs6840362
26600502 RNAi based on different segments of the OPN gene had different down-regulatory effects on OPN expression.
26514514 High osteopontin level was significantly correlated with advanced Hepatitis B-related Hepatocellular Carcinoma.
26491674 A positive expression of OPN predicts a poor response and survival in patients with locally advanced stage IVA/B OSCC treated with cisplatin-based IC followed by CCRT.
26414945 Osteopontin serum levels are negatively related to bone mineral density and positively correlated with bone turnover levels in Chinese postmenopausal women.
26397192 Our results suggest that OPN enhanced chemoresistance of cisplatin in HCC cells by activating PI3K/AKT signaling pathway, blocking the OPN pathway might be a novel way to overcome the disease
26395740 OPN mRNA levels are higher in carotid endarterectomies from patients with symptoms (stroke, transient ischemic attacks, amaurosis fugax) than in asymptomatic patients.
26381542 Data show that higher plasma levels of matrixmetalloproteinases 2/9 (MMP-2/MMP-9), osteopontin (OPN) and interleukin-6 (IL-6) were observed in Non-Hodgkin lymphomas (NHL) patients compared to controls.
26369832 OPN rs17524488 (-156 GG/G), rs11730582 (-443 T/C), and rs9138 (C/A) polymorphisms may be associated with cancer susceptibility in the Chinese population (Meta-Analysis)
26341976 review of role in immune-mediated diseases
26330178 Functional SNPs in osteopontin were associated with increased risk of coal workers pneumoconiosis in a Chinese population.
26280346 Results show high matrix stiffness upregulated OPN expression in hepatocellular carcinoma (HCC) via the integrin beta1/GSK-3beta/beta-catenin signaling pathway and highlight the physicomechanical and biochemical signals contributing to OPN expression in HCC cells.
26267616 Meta-analysis suggests that in Chinese population the -156G>GG polymorphism of SPP1 might be a risk factor for human cancers. For -66T>G polymorphism, it may be a protective factor for human cancers.
26234583 OPN could serve as a prognostic biomarker and as a potential therapeutic target for colorectal cancer.
26210487 Overexpression of OPN is associated with arteriosclerosis.
26203933 SPP1 was identified as a Rheumatoid arthritis susceptibility locus correlated also with joint destruction in seronegative RA.
26201095 Data show that liver and serum osteopontin (OPN) levels correlated with fibrosis stage.
26122937 Plasma OPN levels in alcoholic liver cirrhosis patients without hepatocellular carcinoma (HCC) weren't significantly different from those of cirrhotic patients with HCC. OPN levels increased with advancing tumor stage and with advancing Child-Pugh class.
26111529 Persistently elevated osteopontin serum levels are associated with unfavorable outcomes in patients with critical illness.
26068949 Authors conclude that while all OPN isoforms are frequently co-overexpressed in primary EACs, isoforms OPNb and OPNc enhance invasion and dissemination through collective yet distinct mechanisms.
26033745 results indicate that autocrine OPN plays a crucial role in HPC expansion, migration, and subsequent oncogenic transformation of HPCs, which may provide a new insight into hepatocarcinogenesis
25973097 the strong correlation between bone sialoprotein and OPN and papillary thyroid carcinoma suggests a role for BSP and OPN in calcification and tumor progression of papillary thyroid carcinoma
25973035 OPN overexpression and nuclear beta-catenin expression appeared to be associated with unfavorable prognostic factors in colorectal carcinoma
25972323 Our results support that osteopontin regulates ICAM-1 and VEGFA expression mainly in triple-negative/basal-like breast carcinomas
25972108 This work confirms that OPN, CCL5 and CXCL9 plasma levels are higher in psoriasis patients and provides evidence that their higher levels are not a consequence of obesity.
25963717 A strong positive correlation between the mRNA expression levels of HIF-2alpha, CA9, VEGF, GLUT-1 and OPN suggests a specific hypoxia-associated profile of mRNA expression in glioblastoma multiforme
25944164 High OPN mRNA expression is associated with melanoma progression .
25936410 OPN is increased in serum/muscle of patients with dermatomyositis and polymyositis.
25884485 SPP1 is associated with malignant transformation in NF1-associated MPNSTs and could prove to be an important target for therapeutic intervention
25875742 Elevated osteopontin levels were found in the plasma of type 1 Gaucher disease patients.
25872762 OPN can skew macrophages toward M2-TAMs during gastric cancer progression. The co-existence of OPN and infiltrating M2-TAMs correlates with disease progression and poor survival
25866117 These findings suggested that OPN might increase influenza virus-induced lung injury by augmenting lung epithelial cell apoptosis and impairing the epithelial sodium channel and extracellular matrix destruction.
25862856 OPN, SPINK1, GPC3 and KNPA2 were significantly over-expressed in HCC tissues. These genes may be useful in developing future biomarkers and therapeutic strategies for HCC
25839998 the extensive, negatively charged phosphorylation of OPN is not contributing to alpha(X)beta(2) binding.
25824779 Plasma osteopontin, tissue osteopontin mRNA, and tissue osteopontin protein levels were significantly lower in patients with papillary thyroid cancer and Hashimoto's thyroiditis than in those with papillary thyroid cancer alone.
25809793 SDF-1alpha is involved in homing of CXCR4+ GSLCs and leukocytes and that cathepsin K and osteopontin are involved in the migration of GSLCs out of the niches
25802196 OPN levels appeared to correlate with degree of liver necrosis in acute liver failure.
25796600 The genetic variant rs17524488 in the SPP1 promoter confers high risk for hip osteoarthritis in a Chinese population.
25785266 Significantly lower OPN levels were detected in urine.
25760884 Serum OPN serves as a prognostic index towards the progression of hepatic fibrosis to cirrhosis and hepatocellular carcinoma.
25749383 Osteopontin might promote a cancer stem cell-like phenotype via the alphavbeta3-NF-kappaB-HIF-1alpha pathway in hepatocellular carcinoma.
25732057 The inhibition of OPN may reduce VEGF levels and suppress tumor progression. In vascular pathologies, these two cytokines mediate remodeling, but may also perpetuate inflammation and narrowing of the arteries.
25730089 EGFL7, OPN, and PGE2 may have a role in recurrence and metastasis of hepatocellular carcinoma
25717047 SPP1 SNPs at -443 C>T and -1748 G>A loci may be useful markers for predicting the response to PEG-IFN-alpha-2b plus RBV therapy in Egyptian patients with chronic HCV genotype 4 infection.
25677682 This review focuses on the role of NHE1 and OPN in cardiac remodeling and emphasizes the signaling pathways implicating OPN in the NHE1-induced hypertrophic response.
25658639 Data shows that the expression of Gpnmb and Spp1 is highly upregulated in glioma-associated microglia/macrophages highlighting the importance of macrophages and microglia as therapeutic targets in anti-tumor treatment regimens.
25652109 Serum levels of AFP, DKK1, and OPN were significantly elevated in patients with hepatocellular carcinoma.
25641372 In a Duchenne muscular dystrophy cohort, SPP1 rs28357094 acts as a biomarker of glucocorticoid treatment response.
25625274 The addition of Osteopontin-c immunohistochemistry to standard pathology work-ups may have prognostic benefit in early breast cancer diagnosis.
25620078 Results show endogenous OPN as a major regulatory on glioma-initiating cells stemness phenotype and tumorigenicity implying a greater role than anticipated for OPN in glioblastoma pathogenesis from initiation and progression to probable recurrence.
25600648 Osteopontin was sufficient to induce fibroblast reprogramming and neutralizing antibodies against osteopontin-blocked fibroblast activation induced by tumor cells
25595895 CBX7/HMGA1b/NF-kappaB could take part in the same transcriptional mechanism that finally leads to the regulation of SPP1 gene expression in papillary thyroid carcinoma.
25594638 The plasma osteopontin levels of inflammatory bowel disease patients were significantly higher than those of the normal controls and correlated significantly with their clinical activity indices.
25591760 The -443CC genotype carriers were significantly related to a higher risk for Acute Myeloid Leukemia.
25578972 Expressions of dentin matrix protein (DMP)-1 and osteopontin (OPN) were observed in both normal dentin and dentin from DGI-I affected patients, without significant differences
25555465 OPN is commonly expressed in non-small cell lung cancer(NSCLC) and may guide the evaluation of prognosis with NSCLC, especially for early-stage patients.
25531371 increased plasma levelsare associated with successful venom immunotherapy in children
25531323 this study concludes that tumor-derived OPN engenders mesenchymal stem cells -to-cancer-associated fibroblasts transformation in the microenvironment to promote tumor growth and metastasis via the OPN-MZF1-TGF-beta1 pathway.
25490945 The deficit in crystallization inhibitors such as phytate, and the presence of regulators such as OPN, may play important roles in the development of calcific tendinopathy.
25480426 gestational diabetes is not associated with osteocalcin, under-carboxylated osteocalin, osteopontin and leptin and does not correlate with insulin resistance.
25479069 Serum OPN expression was closely related to the risks of gastric cancer and atrophic gastritis , and it might be a useful marker for the discrimination of gastric cancer and atrophic gastritis
25476232 Multiple sclerosis and susceptibility to celiac disease: an osteopontin gene haplotypes
25476005 There was no significant association between the SNP rs28357094 in the SPP1 gene and the age of ambulation loss
25450502 Site-specific structural characterization of O-glycosylation and identification of phosphorylation sites of recombinant osteopontin.
25449435 Hepatic stellate cells activated by acidic tumor microenvironment promote the metastasis of hepatocellular carcinoma via osteopontin.
25446551 Results show that integrin activation is absolutely required for OPN binding to the alpha4 integrin suggesting that OPN has very low affinity for the alpha4 integrin on human leukocytes under physiological conditions.
25419572 Data indicate Gln34, Gln42, Gln193 and Gln248 as the major transglutaminase 2 (TG2 reactive glutamines in osteopontin (OPN).
25416631 Our results suggest that OPN level changes over time, particularly post-treatment, may yield additional prognostic information in curative-intent radiotherapy of NSCLC.
25405848 Downregulation of osteopontin enhances the sensitivity of glioma U251 cells to temozolomide and cisplatin by targeting the NF-kappaB/Bcl2 pathway
25400775 OPN -443 C/T polymorphism is a potential predictive marker of metastasis and poor prognosis in intrahepatic cholangiocarcinoma patients.
25380749 high osteopontin but low E-cadherin expression can be considered as a negative, independent prognostic factor in patients with locally advanced cervical squamous cell carcinoma
25378811 Serum biomarkers OPN, IP-10, and neutrophil counts are useful in detecting Mycobacterium tuberculosis infection and may have utility in monitoring the course of the disease.
25337248 Suggest that overexpressed SPP1, PAI and caveolin-1 were linked to carcinogenesis and progression, and thus they may serve as potential prognostic factors in oral squamous cell carcinoma.
25329616 The methylation levels in the promoter regions of OPN and integrin beta3 genes in the vascular smooth muscle cells of varicose veins are reduced and the protein expression of OPN and integrin beta3 are increased, compared with normal veins.
25322767 High OPN mRNA expression is associated with alopecia areata.
25290989 Immunohistochemical data show a different pattern of expression between normally healing and fibrotic wounds, thus suggesting a role in fibroproliferation in horses and man.
25278703 OPN is a key mediator of the alcohol-induced effects on hepatic stellate cell functions and liver fibrogenesis.
25277531 a higher risk for gliomas in -443 CC genotype carriers compared to -443TT carriers (P<0.001;the OPN -443 C>T polymorphism was closely related to the gliomas' tumor grade
25271869 Our results demonstrated that the Wnt pathway inhibitor DKK-1 was decreased in CLL. OPN was increased in NHL and associated with extranodal involvement.
25266800 OPN may be a biomarker for predicting the prognosis of gliomas. [Meta-analysis]
25203751 Abnormal expression of OPN in mesenchymal stem cells from degenerated intervertebral discs occurs and plays a pivotal role in the pathophysiological process of human disc degeneration.
25192720 serum OPN levels were generally elevated in ovarian neoplasm patients, and thus, serum levels of OPN could be useful in diagnosing ovarian neoplasm.
25176314 our results suggest that the JAG1/Notch1/OPN cascade represents a potential therapeutic target for hepatocellular carcinoma metastasis.
25172097 RKIP inhibits gastric cancer cell survival and invasion by regulating the expression of HMGA2 and OPN.
25157961 These findings imply a coalescence in cancer cells between osteopontin-a, which increases the cellular glucose levels, and osteopontin-c, which utilizes this glucose to generate energy.
25133167 The aim of this study was to evaluate the relationship between fasting serum OPN concentration and carotid-femoral pulse wave velocity (cfPWV) in geriatric persons.
25132760 Knockdown of OPN gene expression suppresses colon cancer cell growth, adherence, invasion, and expression of angiogenic factors.
25128758 of OPN were found to be independently associated with the severity of coronary atherosclerosis. High plasma OPN levels were associated with increased risk for major adverse cardiac events. Review.
25116355 shows the OPN -66T>G genetic polymorphism contributes to patients' susceptibility to CSM and could be indicative of the outcome of ACF surgery
25112870 Thrombin cleavage of osteopontin disrupts a pro-chemotactic sequence for dendritic cells, which is compensated by the release of its pro-chemotactic C-terminal fragment.
25109745 The prevalence and titer of anti-OPN autoantibodies in hepatocellular carcinoma were significantly higher than these values in normal human serum.
25089309 There is a production of osteopontin by the lungs, unaffected by left ventricular systolic dysfunction or cardiopulmonary bypass.
25086462 OPN may be involved in risk organ dissemination and poor prognosis of Langerhans cell histiocytosis through the function as inflammatory cytokine/chemokine.
25060796 study reports osteopontin-CD44 functional interaction as a hallmark of early stages of calcific aortic valve disease; osteopontin-CD44 interaction mediates calcium deposition via phospho-Akt in valve interstitial cells from patients with noncalcified aortic valve sclerosis
25046773 Hypomethylation of SPP1 is associated with gastrointestinal stromal tumors.
25009318 the polymorphisms rs4754, rs9138 and rs1126772 of OPN gene and rs353639 of CD44 gene were significantly associated with gastric cancer.
25009290 PGC-1alpha drives functional angiogenesis in skeletal muscle via SPP1 induction and macrophage activation.
25007036 Soluble osteopontin is a novel predictor of survival in patients with systemic light-chain amyloidosis.
25000122 functional activities of OPN can be determined by the combined glycosylation and phosphorylation statuses and not by either status alone.
24995304 patients with lower Durie-Salmon stage had significantly lower OPN and VEGF levels (P = 0.05; P = 0.04, resp.). Our preliminary results found positive association between plasma level of OPN, tumor burden, and bone destruction
24969575 High Serum OPN is associated with incipient diabetic nephropathy and cardiovascular disease in type 1 diabetes.
24963635 cell stress induces the upregulation of OPN in AEC II by signaling through the ERK pathway
24950303 The main finding of our meta-analysis revealed that an elevated serum OPN level may be used as a promising diagnostic tool for early identification of PC.
24947165 Up-regulation of osteopontin is associated with gastrointestinal stromal tumors.
24936586 The SPP1 rs9138 variant contributes to joint damage progression in ACPA-negative rheumatoid arthritis.
24928493 This implies that a majority of the acidic residues within OPN must be engaged in calcium interaction under physiological conditions.
24913806 Correlation between OPN gene polymorphisms and the risk of nasopharyngeal carcinoma.
24876663 The trend towards elevated urinary OPN in diabetic subjects results from enhanced glomerulus dysfunction.
24831687 SPP1 htSNP protects against low bone mineral density in middle-aged women
24816798 Data indicate that the osteopontin (OPN) expression rate in non-small cell lung carcinoma (NSCLC) tissue was higher than normal tissue.
24815020 Letter: suggest role for OPN in psoriasis and MetS and documents the absence of any significant differences in the expression of OPN genotypes (T-4754-C and A-9138-C).
24804200 Effect of cyclic mechanical stimulation on the expression of osteogenesis genes in human intraoral mesenchymal stromal and progenitor cells.
24803312 Increased plasma levels of LTBP2 and/or OPN are present in plasma up to 2 years prior to diagnosis of hepatocellular carcinoma.
24758329 secreted phosphoprotein-1 in pleural effusion can be used for the auxiliary diagnosis of MPE and used to determine the prognosis of patients with non-small cell lung cancer
24756245 Results reveal that OPN promotes the progression of gastric cancer through the NF-kappaB pathway.
24718314 These findings characterize OPN as a TGF-beta2 responsive factor.
24714122 Knockdown of OPN may inhibit breast cancer metastasis by regulating alphav,beta3 integrin expression and inducing autophagy and subsequent inhibition of PI3K/Akt/mTOR signaling.
24700685 The study defines the requirement of FOXC2 for phosphate-induced osteopontin (OPN) expression and secretion from cancer cells as necessary for the angiogenic response.
24674683 Osteopontin interferes in the pathogenesis of Systemic Sclerosis in the early stage of fibroblast differentiation process.
24626632 Osteopontin genetic polymorphism modulates skeletal muscle damage.
24607407 The CD44 ligand osteopontin shared a perivascular expression pattern with CD44 and promoted glioma stem cell-like phenotypes.
24548099 It is a phosphoprotein that activates pathways that induce cancer cell survival and metastasis.
24498405 High Osteopontin expression is associated with hepatocellular carcinoma.
24498111 these studies suggest a potential role of OPN in inducing chronic liver disease and HCC associated with chronic HCV infection.
24472267 Suggest that plasma OPN may reflect inflammatory bone destruction in rheumatoid arthritis patients.
24464486 review as promoter for hepatocellular carcinoma metastasis
24460294 Overexpression of ostepontin-c is associated with esophageal squamous cell carcinoma.
24451146 The hypothesis that OPN tumor expression would have independent prognostic value in early breast cancer was not supported by multivariate analysis of this study population.
24448344 Study found a significant contribution of the combination of SPP1 rs11439060 and rs9138 frequent alleles to risk of rheumatoid arthritis, the magnitude of the association being greater in patients negative for anti-citrullinated peptide antibodies.
24440093 In breast carcinomas, our data showed an association of osteopontin with poor prognostic factors, aggressive subtypes HER2 and triple-negative/basal-like, and higher risk of recurrence.
24412090 Osteopontin (OPN) promotes melanoma cell invasion by activating integrin alphavbeta3 and down-regulating CD9, a putative metastasis suppressor.
24400815 Plasma osteopontin predicts sustained vetricular tachycardia in heart failure patients with implantable defibrillators.
24370940 The thrombin-cleaved OPN serum level, but not OPN gene polymorphism, is associated with the development of left ventricular hypertrophy in essential hypertensive patients.
24366422 High osteopontin expression is associated with hepatocellular carcinoma.
24355932 The -443 C>T polymorphism of OPN gene and serum thrombin-cleaved OPN can be used as a biomarker for the susceptibility and prognosis of ischemic stroke.
24347266 our results suggest that osteopontin expressed by tumor-derived microparticles play an important role in bone-marrow derived pro-angiogenic cell mobilization and colonization of tumors
24338767 OPN may have a potential role in pathogenesis of OSCC and it may be used as a tool for monitoring tumor progression.
24327307 Results suggest a mechanism of the interaction of UO2(2+) with bone metabolism and a new role for osteopontin (OPN) as a metal transporter.
24307429 Higher serum levels of osteopontin were found in coronary artery disease patients compared to controls.
24240095 these studies provide an insight into the mechanisms of OPN activation that is relevant to the metastasis of HCV-associated HCC.
24239954 Production of osteopontin by the lungs is unaffected by left ventricular systolic function or cardiopulmonary bypass.
24217817 our preliminary findings suggest that both Th17 and OPN may be associated with the pathogenesis of GBS.
24215488 Osteopontin is a prognostic biomarker in non-small cell lung cancer.
24212839 Hepatitis C genotype 1 patients who were responders to interferon-based therapy had a high frequency of multiple protective polymorphisms in the myxovirus resistance protein, osteopontin and suppressor of cytokine signaling 3 genes.
24188933 When the biliary system leaks, cleaved OPN enters the parenchyma and attracts neutrophils
24175796 The rate of OPN expression in squamous cell carcinoma of the head and neck was 76%. OPN positive cases had lower Hb levels.
24157812 we show that the full-length gene product, osteopontin-a, induces a gene expression profile that is associated with tissue remodeling and directed movement/sprouting. This
24134522 inhibition of TAFIa activity, however, was substrate-specific, because neither mAb inhibited the cleavage of thrombin-activated osteopontin and C5a by TAFIa, thus sparing the anti-inflammatory activity of TAFIa
24129963 cleaved form of OPN plays a critical role in driving iDC differentiation into OC-like MGCs in the early phase of differentiation, in an autocrine and/or paracrine fashion.
24126938 Our results suggest that a reduced expression of osteopontin-1 in endometrial cancer could inhibit the development of invasion and metastasis in these cells.
24123979 umbilical cord OPN was negatively correlated with gestational age in neonates and was associated with cord blood 25(OH)D levels and premature rupture of membrane >18 hours; in preterm neonates, cord OPN levels were associated with patent ductus arteriosus; results raise possibility that OPN has a physiologic role in fetal growth and development
24120738 the rs11730582 polymorphism of osteopontin is associated with NPC risk, and might be served as a genetic susceptibility marker for NPC.
24084141 Higher amounts of OPN were seen in T1DM children. It is assumed that OPN might have inducing effects on T1DM development, particularly when genetically susceptible individuals are predisposed by an environmental insult.
24084099 BAFF regulates T-cell survival by inducing osteopontin secretion in B cells in autoimmune diseases.
24071501 Current evidence demonstrates that BSP and OPN, play significant roles in bone metastasis of osteotropic malignancies derived from breast, prostate, lung, thyroid, and multiple myeloma. [review]
24065086 Our findings demonstrate that OPN/Bcl-2 expression is a promising independent predictor of recurrence and survival in HCC. Additionally, Bcl-2 levels may be regulated by OPN in the HCC microenvironment.
24021319 SPP1 expression is significantly lower in the endometrium of adenomyosis patients than in controls
24012693 High level of osteopontin expression is associated with breast cancer.
24005026 Our data do not support a role for circulating OPN levels as a biomarker for disease activity in multiple sclerosis
23995733 The serum OPN level in rheumatoid arthritis patients was not significantly correlated with disease activity. The serum OPN level in both responders and non-responders after therapy was significantly decreased regardless of responsiveness to therapy.
23992637 The level of OPN expression in lung adenocarcinoma was associated with decreased apoptotic activity of tumor cells, and correlated with alphav integrin expression, particularly in low stage tumors.
23952692 rs9138 and rs1126616 of OPN were associated with CRC risk
23910387 Plasma OPN in neuromyelitis optica patients may be a useful marker, playing an important role in inflammation, disease activity and disease progression, as well as multiple sclerosis.
23900428 the osteopontin promoter SNPs -443 (rs11730582) and -1748 (rs2728127) are important for gene expression and breast cancer aggressiveness.
23891093 Plasma OPN increased continuously in malignant glioma patients and was associated with poor survival
23883434 OSTEOPONTIN -443C/T polymorphism is a potential predictive marker of survival in lung cancer patients, it is correlated with bone metastasis significantly.
23880208 Elevated OPN in plasma can be considered as an independent predictor of coronary calcification in type 2 diabetes patients with known coronary artery disease.
23875677 Levels of osteopontin are lower in patients with endometriotic ovarian cysts than in those with other benign ovarian tumors
23867349 The high Osteopontin expressions were significantly more prevalent in -443CC carriers than TT carriers.
23793814 It is a valuable marker for grading meningiomas and for predicting the recurrence in WHO grade I tumors.
23784265 Urinary calcium/OPN ratios were higher and lower in subjects with predisposing and protective SNPs of SPP1 gene, respectively. Of 28 constructed haplotypes, 6 demonstrated signicant association with calcium oxalate urolithiasis risk.
23775819 Statistical analysis of clinical and pathological features demonstrated that the expression of osteopontin, TGFbeta2, and laminin in the stroma of intrahepatic cholangiocarcinoma was significantly correlated with overall patient survival.
23774402 Increased osteopontin expression promotes cell migration in gastric cancer.
23764959 a high expression of OPN in adipose tissues may not be correlated with serum OPN levels in obese humans.
23729174 a role for OPN in the pathogenesis of alcoholic hepatitis.
23728336 Data indicate the role of osteopontin (OPN) under hypoxia and in breast tumor growth and angiogenesis through NF-kappaB-mediated HIF1alpha-dependent vascular endothelial growth factor (VEGF) expression.
23726130 High expression of osteopontin in breast neoplasms was associated with cytokeratin-positive cells in bone marrow, but not with lymph node metastasis.
23717583 results demonstrated that CCL20 might serve as a biomarker for GD and suggested the possible role of OPN in induction of CCL20 expression
23711950 These study highlights osteopontin as a biomarker for malignancy in the form of invasion but not to study progression from dysplasia to malignant transformation.
23692545 This study investigates the occurrence of Ala250 polymorphism in the OPN gene and finds an association between weight gain and urolithiasis.
23680656 ERRa and OPN are co-expressed and higher in colorectal cancer cells as opposed to normal mucosa. Data provide compelling evidence that OPN is a direct target of ERRa, the induction of which could clearly contribute to colorectal cancer pathogenesis.
23675517 The expression levels of OPN and IL-18 are simultaneously increased in blood and adipose tissue in overweight/obese individuals which may trigger the development of obesity-associated insulin resistance.
23652051 demonstrate that OPN contributes to A549 cell metastasis by stimulating cell invasion, independent of cellular migration and proliferation
23636305 high expression of CXCR7 increases the risk of metastasis in post-resective hepatocellular carcinoma patients with relatively good differentiated tumors, potentially through upregulation of osteopontin.
23619422 An excess of OPN is associated with increased lysyl oxidase and insoluble collagen, as well as with left ventricular stiffness and systolic dysfunction in patients with hypertensive heart failure.
23619316 Osteopontin is critical in epithelial-mesenchymal transition initiation in breast cancer through activation of Twist via serine phosphorylation. It also increases expression of Snail and Slug.
23614633 Variations in the osteopontin gene are determinants of a genetic predisposition to suffer external apical root resorption secondary to orthodontic treatment
23613225 A high OPN level, especially in combination with a high hsCRP level, was associated with poor long-term outcome in STEMI patients treated with primary percutaneous coronary intervention.
23589674 ALL interacts with extracellular OPN within the malignant BM, and that this interaction induces cell cycle exit in leukemic blasts, protecting them from cytotoxic chemotherapy.
23578778 we found that OPN, which plays a role in Th2 mediated inflammation, may also play a role in childhood asthma
23545719 the expression and localisation of the proteins, osteopontin (OPN) and prominin-1 (CD133), as well as the plasma OPN levels in the endometrium of patients with endometriosis, were investigated.
23515922 elevated circulating osteopontin levels in patients with decreased bone mineral density, consistent with a modest contribution of an OPN allelic variation to its expression.
23508392 Investigate collagen, CTGF and osteopontin ezpression in patients with ascending thoracic aortic aneurysms; results demonstrated that collagen, CTGF and osteopontin levels significantly increased in the ATAA group than in the control group.
23441154 osteopontin, LAMB3 and ITGB1 played important roles in the occurrence and metastasis of lung cancer, thus provided important clues to understanding the molecular mechanism of metastasis.
23437160 Our findings suggest that osteopontin might be useful as a novel prognostic biomarker in patients with impaired thyroid function.
23427088 data suggest that the promineralization role of TNAP may be related not only to its accepted pyrophosphatase activity but also to its ability to modify the phosphorylation status of OPN.
23426449 Our results suggest that polymorphisms in the OPN promoter are associated with the development of gastric cancer, and the combination of SNP -443 (T/C or C/C) and -616 (T/T or T/G) most significantly increases susceptibility to gastric cancer
23416968 Tumor-derived OPN transcripts participate in the alternative activation of monocytes, which may represent another essential mechanism of immune evasion mediated by OPN.
23407481 Data suggest a potential benefit of using osteopontin, TIMP-1, and CA 19-9 in a panel to improve diagnostic accuracy in pancreatic ductal adenocarcinoma.
23388534 the pathogenic role of osteopontin and adiponectin in the formation of arterial hypertension in adolescents with obesity
23382482 The N-terminal fragment of osteopontin, rather than full-length OPN or C-terminal OPN, is associated with carotid plaque inflammation in hypertensive patients.
23373240 Expression of OPN, CD44v6 and MMP-9 are positively related and involved in the invasion and metastasis of laryngeal squamous cell carcinoma.
23361573 OPN plays an important role in the immune inflammatory response and is also involved in the mucosal protective mechanism in inflammatory bowel diseases.
23354516 the osteopontin gene, which is involved in merlin protein degradation, was upregulated, which suggests that this mechanism may also exert a pivotal role in schwannoma merlin depletion.
23352191 Osteopontin expression at mRNA and protein level was significantly decreased in placenta (p < 0.05) of small fetuses in discordant monochorionic twins.
23343383 High circulating OPN levels preceded increased cumulative disease activity and organ damage in systemic lupus erythematosus patients
23289928 Our findings suggest that certain OPN gene polymorphisms may be used as molecular markers for the susceptibility and severity of osteoarthritis
23284864 we identify differential osteopontin expression and phosphate excretion as putative factors of allograft calcification.
23274598 OPN is a sexually dimorphic modifier of muscle size in normal humans and mice and responds to muscle damage.
23269624 Our result showed the role of OPN in endometrial cancer, in particular on the malignancy-promoting aspects of OPN.
23263636 Our results showed that a combination of hypoxic markers is more robust than a single marker for predicting survival in high-grade glioma.
23251004 These results suggest that the OPN-CD44 interaction is important for colorectal cancer progression and could serve as a potential therapeutic target for the treatment of colorectal cancer.
23244138 High osteopontin expression is associated with breast calcification leading to breast cancer.
23235966 SPP1 polymorphisms were found to be associated with nephrolithiasis and it may be suggested that SPP1 gene polymorphism could be a useful marker for evaluation of the early genetic risk factor in childhood nephrolithiasis.
23232694 Data show that abnormalities in osteopontin (OPN) induction in XPD (ERCC2) mutant fibroblasts indicate mutation-dependent aberrant transactivation of the nuclear receptor for vitamin D (VDR).
23204518 Thrombin/CPB2-double-cleaved OPN (OPN-L) levels were markedly increased in glioblastoma (GBM) and non-GBM gliomas compared with systemic cancer and noncancer patients.
23203407 High serum osteopontin level is associated with recurrence in hepatitis B-related hepatocellular carcinoma
23166604 Osteopontin level in synovial fluid is associated with the severity of joint pain and cartilage degradation after anterior cruciate ligament rupture.
23165334 higher expression is associated with more advanced neoplasm staging in Chinese patients with pancreatic ductal adenocarcinomas
23132541 Report higher phosphorylation level of OPN in osteoarthritic cartilage than in normal cartilage.
23122494 The preoperative serum osteopontin level was a useful predictor of an unfavorable prognosis, and it was an independent prognostic determinant of outcome in patients who underwent surgery for non-small-cell lung cancer
23119061 Overexpression of osteopontin, alphavbeta3 and Pim-1 associated with prognostically important clinicopathologic variables in non-small cell lung cancer.
23117696 High levels of osteopontin in postmenopause are associated with low bone mineral density and osteoporotic vertebral fractures.
23112867 OPN was highly expressed in metastatic hepatic lesions from colorectal cancer compared to primary colorectal cancer tissue and adjacent normal mucosa.
23098767 OPN levels are significantly elevated in the induced sputum of smoking asthmatics, compared to non-smoking asthmatics and healthy controls.
23097037 Plasma OPN levels were higher in BD patients than in healthy controls and were found to be associated with disease activity, severity and vascular involvement.
23089492 Neither CD44H nor CD44v6 scores correlated with the osteopontin expression score or Ki-67 index. Osteopontin immunoexpression was highest in PCNSL, suggesting its probable role in its pathogenesis.
23079960 The genetic variation at locus -443 of the OPN promoter plays important roles in the regulation of OPN expression and cancer progression of hepatocelluar carcinomas, which is a novel determinant and target for metastasis and prognosis.
23074199 These results indicate that osteopontin activates Nrf2 signaling, resulting in enhanced HO-1 expression and cell migration in glioma cells.
23072570 Data indicate that variation at nt -443 in the osteopontin (OPN) promoter increases the potential for gastric cancer metastasis and subsequent death in the Chinese population.
23071279 CCR2(+)CCR5(+) T cells produce matrix metalloproteinase-9 and osteopontin in the pathogenesis of multiple sclerosis.
23055574 Findings suggest that OPN, HMGB1, and CTGF contribute to the pathogenesis of proliferative vitreoretinal disorders.
23033660 overexpression of osteopontin may play an important role in myocardial fibrosis
23008732 Only osteopontin gene +1239A > C SNP displayed a statistically significant association with MS development.
22978720 Endothelial-derived osteopontin may contribute to inflammation in smokers, and may also contribute to atherosclerosis and cardiovascular disease-related processes.
22964303 Data suggest that the signaling elements IL-6, IL-8, OPN, TLN1, and CTGF are involved with NF-kappaB p65 in random positioning machine (RPM)-dependent thyroid carcinoma cell spheroid formation.
22960022 Phenotypic expression of alpha-smooth muscle actin, smooth muscle myosin heavy chain 2, and smoothelin were significantly decreased in the dissected media, whereas that of osteopontin was elevated.
22935225 Serum osteopontin concentrations were elevated in patients with idiopathic retroperitoneal fibrosis.
22927944 BRMS1 sensitizes HCC cells to apoptosis through suppressing OPN expression
22918393 CA9, osteopontin and CRP were univariately prognostic for overall survival (OS).
22895562 Elevated OPN levels indicated poor prognosis in connection with advanced stage of the urothelial cell carcinoma of the urinary bladder.
22882568 Higher immunostaining intensity for OPN and LMX1A correlated with WHO grades for meningiomas and some gliomas. Contrary to our expectations, LMX1A staining in WHO grade IV gliomas was shown to be weaker than in WHO grade III tumours.
22855173 The inverse relation between OPN and EGFR at the protein level could probably reflect dynamic changes that EGFR undergoes following activation.
22847114 Osteopontin increases the expression of beta1, 4-Galactosyltransferase-I and promotes adhesion in human RL95-2 cells, the activity critical for embryo implantation.
22844418 the role of the bone resorption marker CTX and osteopontin in gestational diabetes
22835614 Mesothelin, megakaryocyte potentiating factor and osteopontin are expressed in malignant mesothelioma [review]
22818182 Data show that interleukin-17 and osteopontin are increased in the peripheral blood of patients with chronic hepatitis B (CHB).
22807608 OPN plays a significant role in the proliferation of hepatocellular carcinoma through interaction with the cell surface receptor CD44
22784028 OPN was expressed in decidual stromal cells in human first-trimester decidua and in the uterus in mice at 7.5 gd.
22779921 OPN physically interacts with microtubule-associayed proteins, MAP1A and MAP1B.
22744661 SPP1 genotype is a disease modifier in Duchenne muscular dystrophy.
22730056 Serum osteopontin refelects the severity of liver damage in hepatitis C virus infected subjects.
22711477 promotes inflammation in patients with acute coronary syndrome through its activity on IL-17 producing cells
22710694 Age negatively correlated with preoperative urinary osteopontin in obstructed hydronephrotic kidneys.
22699784 the -156 GG/G and -443T/C polymorphisms of Osteopontin (OPN) might be used as a genetic marker for cervical cancer susceptibility.
22684781 OPN and MMP-9 may be regulated by TNF-alpha, indicating a possible role in the pathogenesis of psoriasis.
22675553 The interaction between HGF and c-Met increases OPN expression in human osteoblasts via the PI3K, Akt, c-Src, c-Jun, and AP-1 signaling pathway.
22658130 Our findings suggest that higher level of OPN and CD44v6 expression in epithelial cells of some lesions such as odontogenic keratocysts and calcifying odontogenic cysts can explain the local aggressive behavior of them.
22640692 The severity of coronary artery disease (CAD) and arterial stiffness is positively associated with osteopontin levels and with the extent of CAD.
22629140 We conclude that serum levels of HGF, OPN, and SYN correspond to the activity of MM and might become useful in differentiation of MGUS, asymptomatic MM, and overt/symptomatic form of MM.
22611763 Our study suggests that OPN is involved in the pathophysiology of psoriasis, and a possible association with disease severity.
22591637 FLJ10540 may be critical regulator of disease progression in nasopharygeal carcinoma, and the underlying mechanism may involve in the osteopontin/CD44 pathway.
22584029 Osteopontin C443T polymorphism may be a significant risk factor for diabetic nephropathy in type 2 diabetic patients.
22580396 OPN plasma concentrations decreased after coronary artery by-pass grafting surgery in the early post-operative period.
22558919 Data suggest that in women with Hashimoto's thyroiditis no statistically meaningful relation exists between osteopontin or TNF-alpha serum levels in patient groups with/without miscarriage history.
22530059 OPN increased in the liver, adipose tissue and serum with liver fibrosis in alcoholic patients.
22525502 The expression of OPN was positively correlated with the enhanced metastasic potential of hepatocellular carcinoma.
22516995 OPN expression is upregulated in the basal and surface of labial glands of primary Sjogren's syndrome patients.
22510874 OPN expression is an independent prognostic factor in AML.
22499302 Osteopontin expression seems to be related to Ki-67 (proliferation index) and CD34 expression (angiogenesis marker) confirming its role in the pathogenesis of psoriasis.
22495819 Both osteopontin-c and osteopontin-b splicing isoforms exert pro-tumorigenic roles in prostate cancer cells.
22492090 Ischemia-induced OPN expression is hydrogen peroxide dependent and is a critical mediator of postischemic neovascularization.
22490528 Review: In the progression of non-alcoholic fatty liver disease, the hedgehog (Hh) pathway has recently been implicated, with a new target gene, osteopontin (OPN), being a candidate in the coordination of inflammation and fibrosis development.
22461132 Low osteopontin expression is associated with pancreatic ductal adenocarcinoma.
22458913 Increased OPN levels were observed in children with solitary functioning kidney and correlated with glomerular filtration rate.
22456539 stretch-induced CD44v7 over joints, in concert with dysregulated osteopontin levels in the skin of dermatomyositis patients, increases local inflammatory cell recruitment and contributes to the pathogenesis and resistance of Gottron's papules.
22431140 TGFBR2 but not SPP1 genotype modulates osteopontin expression in Duchenne muscular dystrophy muscle.
22421411 In all cases of IL-6- or OPN-induced resistance, the effective concentrations of erufosine were still within the clinically achievable range.
22410369 DSPP, OPN, or MMP-9 expressions at histologically-negative surgical margins predict Oral squamous cell carcinoma recurrence with MMP-9 being the preferred predictor.
22402440 These data demonstrate an important role for OPN in the development of dermal fibrosis and suggest that it may be a new therapeutic target in systemic sclerosis.
22329905 Both OPN and IL-23 may play pivotal role in development of multiple sclerosis (MS) and might be specific markers and therapeutic targets for MS.
22261033 Cigarette smoke induction of osteopontin (SPP1) mediates T(H)17 inflammation in human and experimental emphysema
22242114 This study identified OPN haplotypes as modifiers of Crohn's disease susceptibility.
22219064 High osteopontin expression is associated with colorectal cancer hepatic metastasis.
22218639 Hyaluronic acid can upregulate OPN mRNA expression in osteoarthritis fibroblast-like synoviocytes.
22207105 Osteopontin is involved in cholesterol gallstone formation, and the role of osteopontin might correlate with integrin alphav and calcium.
22186244 elevated expression in sinonasal inverted papilloma is associated with clinical severity
22179617 a novel mechanism regulating the interaction of OPN and the alpha(V)beta(3)-integrin by modification of the highly conserved C-terminal region of the protein.
22175901 Osteopontin was conspicuously upregulated in patients with muscular dystrophy
22158061 Data show that the mRNA expression levels of beta-catenin, Runx2, Sox9 and osteopontin were significantly higher in ossification of ligamentum flavum (OLF) cells than in non-OLF cells.
22131818 In this study, we find that both of these alleles are independently associated with distinct clinical features in SLE patients, supporting divergent roles for these alleles in the pathogenesis of SLE.
22115341 The change in serum fetuin-A, matrix Gla protein (MGP), and osteopontin (OPN) levels after intracerebral hemorrhage (ICH) indicates that these parameters play a role in the pathophysiological processes leading to an ICH.
22096023 High plasma osteopontin is associated with head and neck squamous cell carcinoma.
22093695 OPN splicing variants OPN-a, OPN-b, and OPN-c are differentially expressed during CAVD progression and are able to inhibit biomineralization in a cell-based biomineralization assay.
22080623 Examined for osteopontin (OPN) gene C/T polymorphism in 78 patients (53 girls) with vesicoureteric reflux, with or without renal scarring. The T allele frequency was associated with a significantly increased risk (26.4 fold) of renal scarring.
22039306 we have identified alpha(9) integrin-mediated signaling by TN-C and OPN as a novel intrinsic regulator of pathogenic Th17 cell generation that contributes to the development of rheumatoid arthritis.
22038347 OPN and NF-kappaB P65 were involved in the pathogenesis of aortic aneurysms. OPN can up-regulate the expression of MMP and uPA via NF-kappaB signaling pathway.
22037626 Osteopontin plasma levels were significant in active pemphigus vulagaris, particularly in those patients with both skin and oral pemphigus. Osteopontin might drive the immune responses playing an important role in pemphigus onset.
22037483 In this study we demonstrated that AhR positively regulates OPN expression in lung cancer.
22031818 The results suggest that sOPN in airways (1) undergoes extensive post-translational modification by polymerization and proteolytic fragmentation, (2) is more fragmented and less polymerized in mild to moderate asthma.
21992455 The prognosis of Ampullary cancer patients can be estimated based on immunohistochemical classification and OPN status.
21986140 High Osteopontin levels are associated with asthma.
21983451 analysis of urinary OPN excretion in children with glomerular proteinuria
21968021 Peripheral blood osteopontin (OPN) and endostatin (END) levels were studied in 35 patients with adrenal cortex tumors and 10 patients with pheochromocytoma before unilateral adrenalectomy, as well as in 10 healthy subjects (controls).
21963599 OPN-splicing isoforms were overexpressed in prostate cancer tissues, strongly associated with prostate cancer occurrence and with tumor cell differentiation
21962803 Osteopontin is associated with scar and exerts pro-scarring effects by increasing cellular migration, adhesion, proliferation, and contractility of human dermal fibroblasts.
21953299 OPN plasma levels were significantly elevated in hepatocellular carcinoma patients, compared to cirrhosis, chronic hepatitis C chronic hepatitis B, or healthy controls.
21935388 omentin-1 serum levels are correlated with BMD at the femoral neck and the serum levels of osteocalcin and osteopontin in MS patients
21909361 Recombinant human osteopontin up-regulates MMP-2 through the SDF-1alpha/CXCR4 axis.
21900386 These data indicated a clinical correlation between serum OPN levels and Graves disease.
21867616 Expressions of OPN and VEGF are closely related with acute leukemia occurrence and development. OPN may regulate VEGF expression and promote angiogenesis.
21853313 osteopontin in laryngeal and hypopharyngeal carcinomas associated with differentiation and metastasis
21842122 The selective down-regulation of Osteopontin expression by RNAi may lead to S-phase arrest, apoptosis and a decline in the malignant phenotype in PC-3 cells.
21838826 combination of OPN with the well-established tumour marker S100 might increase the prediction of metastases
21822558 In a cohort analysis of disease-free survival, aberrant tumor expression of osteopontin and glypican 3 were prognostic factors for recurrence and poor outcome.
21810982 OPN may be relevant to the pathogenesis of VKH disease. The TT genotype of rs4754 may be a susceptible factor for VKH disease in a Chinese Han population.
21796134 OPN has a functional role in the development of diastolic dysfunction in hypertensive hearts.
21785824 The down-regulation of OPN by shRNA inhibits the growth and migration of CNE-2 cells.
21772333 Results suggest that Tcf-4 can act as a repressor or activator of breast cancer progression by regulating OPN (osteopontin) expression in a Wnt-dependent manner.
21768699 osteopntin mRNA and protein overexpression in nasopharyngeal carcinoma may be important in the pathogenesis of the disease
21763380 Osteopontin regulatory polymorphisms are associated with systemic sclerosis in Italian patients.
21743018 OPN is widely distributed in the human eye and was found in lower concentrations in primary open-angle glaucoma aqueous humor. Reduction of OPN in young mice does not affect IOP.
21706367 elevated OPN level in plasma and tumor tissues was significantly associated with metastasis and survival of laryngeal and hypopharyngeal carcinomas.
21703197 Secreted OPN, induced by LSF, activates c-Met via a potential interaction between OPN and its cell surface receptor CD44. A significant correlation was observed among LSF, OPN, and activated c-Met levels in HCC.
21673011 These data suggest that stromal-derived osteopontin impacts tumorigenesis by stimulating preneoplastic cell proliferation thus allowing expansion of initiated cells in early lesions.
21669963 OPN is an ERG-target gene in PCa where the abnormal expression of the transcription factor ERG, due to the TMPRSS2:ERG fusion, disturbs the expression of genes that play an important role in PCa cells and associated metastases.
21645921 Elevated levels of osteopontin is associated with T cell leukemia.
21632990 results suggest a possible role for osteopontin in the formation of microcalcification in papillary thyroid carcinoma.
21630219 Expression and regulation of alpha7-nAChR nicotine receptor and osteopontin isoforms in pancreatic ductal adenocarcinoma.
21616556 overexpression of OPN in glioma cells stimulates the in vitro angiogenesis of endothelial progenitor cells via activation of the avBeta3/PI3-K/AKT/eNOS/NO-dependent signaling pathway, but not upregulation of VEGF-related signaling molecules.
21609000 Structural biology studies suggest that OPN is an intrinsically unstructured protein in solution; conformational flexibility combined with modular architecture represent an important structural prerequisite for OPN functional diversity.
21585607 The increased OPN expression correlated with more severe chronic gastric inflammation.
21556958 Osteopontin enhances HIV replication and is increased in the brain and cerebrospinal fluid of HIV-infected individuals.
21547579 The impact of VHL genetic alterations on the expression of several pVHL protein targets in paired normal and tumor tissue, was evaluated.
21539822 Plasma OPG and OPN levels were significantly associated with inflammation and arterial hypertension.
21521652 Autistic children had significantly higher serum osteopontin levels than healthy controls. Children with severe autism had significantly higher serum osteopontin levels than patients with mild to moderate autism.
21520066 Osteopontin regulated endothelial cell activation in vitro and in excised tissue from calcific aortic stenosis patients and controls. High osteopontin levels have been shown in both tissue and plasma of patients with aortic valve sclerosis and stenosis.
21513757 increased serum level in active stage of Behcet's disease
21512310 Osteopontin as a key mediator for vasculogenic mimicry in hepatocellular carcinoma.
21508397 High osteopontin is associated with renal failure in mesothelioma.
21501293 Thrombin-cleaved forms of sOPN and TN-C share a common integrin receptor, alpha9beta1, and alpha9beta1 integrin-mediated signaling is involved in the pathogenesis of various autoimmune diseases.
21487672 Recombinant human bone morphogenic protein-7 and osteogenic differentiation medium up-regulated osteopontin in human bone-marrow-derived mesenchymal stem cells in vitro.
21487066 Data suggest that plasma markers: CEACAM, ICAM-1, osteopontin, MIA, TIMP-1 and S100B particularly when assessed in combination, can be used to monitor patients for disease recurrenc.
21486700 The aim of the study was to evaluate and compare the circulating concentrations of OPN, E-selectin and END of severely obese patients with metabolic syndrome before and after vertical banded gastroplasty.
21469198 There was no statistically significant difference in incidence of the TT genotype in patients with clinically symptomatic Parkinson's disease (88.9%) and other Gaucher patients (72.1%).
21467192 Osteopontin is an activator of human adipose tissue macrophages and affects adipocyte function.
21443102 SPP1 is upregulated in gastric adenocarcinoma and is associated with tumor progression.
21440761 OPN may have a role in increased cardiovascular risk in renal transplantation patients
21397972 elevated plasma levels in malignant mesothelioma patients
21375772 Data from microRNA and microarray analysis suggests dissimilar endometrial receptivity in patients with high P levels on the day of hCG, and elevated osteopontin and decreased VEGF had poor pregnancy rates.
21374592 Osteopontin stimulates autophagy directly through integrin/CD44 and p38 MAPK-mediated pathways in vascular smooth muscle cells
21366712 High plasma OPN and low plasma Se levels are predictable factors for occurrence of psoriasis
21365018 The HMGB1/RAGE/OPN/Egr-1 pathway may be involved in inflammatory, angiogenic and fibrotic responses in proliferative vitreoretinal disorders.
21343932 Expression of osteopontin coregulators in primary colorectal cancer and associated liver metastases.
21321126 Osteopontin undergoes polymerization in vivo and gains chemotactic activity for neutrophils mediated by integrin alpha9beta1.
21315424 This study demonstrates that osteopontin is frequently expressed in ovarian carcinoma effusions and its presence in tumor cells is associated with less aggressive clinical course.
21290088 changes in Osteopontin level have a determinant effect on the sizes of tumours
21273622 Increase osteopontin level was associated with metastatic uveal melanoma.
21273567 OPN-induced neuroprotection is associated with cleaved-caspase-3 inhibition and antiapoptotic cell death in brains of immature rat pups after hypoxic-ischemic injury.
21272459 OPN promotes hepatocellular carcinoma metastasis though the Integrin av/CD44V6/MAPK pathway.
21263033 OPNc-specific expression in ovarian tumor samples and its role on favoring different aspects of ovarian cancer progression suggest that secreted OPNc contributes to the physiopathology of ovarian cancer progression and tumorigenesis.
21252118 increased mesenchymal stromal cell migration to metastatic sites in lung and liver; this mechanism is both osteopontin and CCL5 dependent
21247495 Data suggest that expression of thrombin-uncleavable OPN imparts an early tumor formation advantage as well as a metastatic advantage for breast cancer cells, possibly due to increased proteolytic activity and decreased adhesion and apoptosis.
21217752 osteopontin is regulated by TRAP in the pathogenesis of common autoimmune disorders
21207061 High Osteopontin is associated with lung cancer.
21190594 c-Myb has a functionally important role in the regulation of OPN expression in hepatocellular carcinoma
21188534 Expression of OPN in the tissue of hepatocellular carcinoma is related to metastasis or metastases.
21178099 Osteopontin (SPP1) genotype is a strong genetic modifier of disease severity in Duchenne muscular dystrophy.
21174062 OPN-targeted therapy may be a promising strategy for the treatment of hepatocellular carcinoma metastases.
21167650 Indicate that p65 NF-kappaB signaling pathway may be involved in OPN-mediated clear cell renal cell carcinoma progression, partly by protecting tumor cells from apoptosis.
21167394 Data suggest that plasma osteopontin may be a diagnostic biomarker for hepatocellular carcinoma (HCC), and could also serve as an adverse prognostic factor for hepatitis C virus-related HCC patients.
21165579 Value of Osteopontin as a cancer biomarker.
21152079 Data show that expression of SPARC and SPP1 was significantly associated with OS of EAC patients.
21104439 OPN enhanced hepatocellular carcinoma cells invasion through interaction with its receptor CD44v6 and increased MMP-2 and uPA expressions.
21071960 No association is found between plasma osteopontin levels and aortic calcification score in patients with chronic kidney disease.
21067798 Observational study of gene-disease association. (HuGE Navigator)
21044748 marked associations between polymorphisms (C6982T and T-593A) of the OPN gene and the stone-forming phenotypes in the Turkish population
21044748 Our results showed marked associations between polymorphisms (C6982T and T-593A) of the OPN gene and the stone-forming phenotypes in the Turkish population.
21044748 Observational study of gene-disease association. (HuGE Navigator)
21034455 Demonstrate an independent association between plasma levels of OPN, but not thrombin-cleaved OPN, and the presence and severity of nephropathy and coronary artery disease in diabetes.
21028999 Our results suggest that OPN and adiponectin are related to each other underlying the mechanisms of RAAS and inflammation.
20978319 hnRNP A2/B1 and osteopontin expression was variable in CCRCCs and had no association with VHL genetic status.
20967551 Patients with higher levels of serum osteopontin (OPN) display worse symptoms following ischemic stroke when compared to those with lower osteopontin levels, perhaps validating OPN as a useful tool in predicting long-term stroke outcome.
20967421 OPN plasma levels are associated with the genetic polymorphisms in its structural gene locus (SPP1)
20967421 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20961744 mRNA levels of the novel inflammatory factors lipocalin-2, chitinase-3 like-1 and osteopontin are increased in human visceral abdominal tissue of subjects with colon cancer.
20935448 Data show that TNF-alpha and osteopontin levels are not different between obese patients with and without obstructive sleep apnea syndrome, but that osteopontin levels increase with fasting insulin, IR, OSAS severity, and daytime sleepiness.
20921238 Osteopontin concentrations are increased in cerebrospinal fluid during attacks of multiple sclerosis.
20890897 hrombin plays an important role in OPN-mediated HCC metastasis and proliferation of HCC cells in vitro. The mechanism by which thrombin acts may be through the activation of integrin beta1-FAK signaling.
20874252 The downregulation of the level of OPN contributes to the therapeutic effects of IFN-beta in Multiple sclerosis(MS).
20868520 OPN may have dual effects in the activation of Erk1/2 in PC3 human prostate cancer cells.
20863582 Circulating OPN may represent a marker of left ventricular (LV) dilation/impairment and an indicator of the response to heart failure therapies promoting LV reverse remodelling.
20851233 OPN, IL-6 and LIF may have critical roles in human pregnancy maintenance.
20849637 OPN seems to be an attractive target to improve the effectiveness of radiotherapy.
20823889 Osteopontin levels are also markers for stage, grade, and early tumor progression in multiple cancers, reflecting a common molecular underpinning for distinct clinical measures
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20796249 Osteopontin is likely to contribute to the development of inflammation in patients with eosinophilic pneumonia.
20689445 OPNa expression was increased in non-small cell lung cancer.
20659235 Suggest that OPN is commonly expressed in hepatocellular carcinoma (HCC) and is a useful marker for predicting the prognosis of patients with the TNM stage I HCC.
20638909 immunohistochemistry of the endometrium indicates that the use of osteopontin and alphavbeta3 integrin as targets for contraceptive approaches or understanding of the pathogenesis of infertility offer little benefit compared with histological dating
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20625700 A decrease of osteopontin and osteocalcin in bone is important for promoting vulnerability to hip fracture.
20598232 A link might exist between NECL1 and the extracellular matrix protein OPN in inhibiting the migration and invasion of U251 glioma ce
20597997 Studies indicate that understanding OPN-mediated interactions within a tumour will be important for the development of therapeutic strategies to target OPN.
20592361 analysis of OPN expression in thyroid carcinoma
20576283 Plasmid constructs using a luciferase reporter with variable OPN 3'UTR mutations were transfected into 2 HCC cell lines to determine miRNA-181a regulation of OPN expression.
20562127 Serum and bronchoalveolar-lavage-fluid osteopontinlevels were significantly increased in all asthmatics in the steady state, whereas serum levels decreased during exacerbations. Osteopontin was upregulated in the bronchial tissue of all patients.
20553297 In the context of allergic airway responses, CC10 can inhibit OPN expression and suppress the Th2-promoting function of OPN, resulting in CC10's inhibitory biological effects.
20549562 OPN and its interaction with CD44 were related to increased mitosis and significantly enhanced GIST tumor cell proliferation in vitro
20545695 OPN expression is increased in ovarian clear cell carcinoma (OCCC), and that OPN induced ECM invasion in vitro by binding alpha v beta 1, alpha v beta 3, and alpha 5 beta 1 integrins in OCCC.
20533542 Endogenous Osteopontin produced in Rheumatoid Arthritis Synovial Fluid was responsible for markedly increased production of IL-17 in T cells
20511184 different splice variants of OPN have divergent functions in regulating apoptosis and invasion of glioma cells
20505679 Variants of the SPP1 promoter might influence the risk of glioma by regulating promoter activity.
20505679 Observational study of gene-disease association. (HuGE Navigator)
20501415 The positive expression rates of OPN mRNA and protein in prostate cancer tissue were significantly correlated to survivin expression.
20495387 Increased expression of osteopontin is associated with metastatic growth of pancreatic cancer.
20486203 OPN is an independent predictor of mitral annular calcification and aortic valve sclerosis. Plasma OPN levels reflect the extent of coronary stenosis and can be used as a biomarker to identify patients with coronary atherosclerosis.
20459645 blocking of OPN-induced ICAM-1 expression through mTOR/p70S6 kinase signaling pathway may be an important therapeutic strategy for the treatment of breast cancer.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20428925 Osteopontin immunohistochemistry score may play a role in prediction of the recurrence of the grade I meningiomas
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20384635 natural mutant allele of BRCA1 (Mut.BRCA1) can elicit some of the changes involved in metastatic progression in human breast cancer via the overexpression of OPN.
20378012 SPP1 variants marked by +1239C are associated with T1DM development in the Italian population.
20378012 Observational study of gene-disease association. (HuGE Navigator)
20377868 Data suggest OPN protein in serum as well as in tumor tissue extracts is an important prognostic factor for soft tissue sarcoma patients.
20349162 Determined the proliferative/apoptotic epithelial cell ratio (PAR) in the adenoma-dysplasia-carcinoma sequence (ADCS), and to examine its association with osteopontin (OPN), a previously identified protein product related to cancer development.
20224789 the RGD domain of both OPN-A and B promote tumor growth and metastasis mainly by protecting cells against apoptosis under stressed conditions and not via migration or invasion
20219412 tissue OPN expression correlates to oral squamous cell carcinoma (OSCC) progression. -156 insGG/insGG genotype is associated with OSCC susceptibility and higher OPN expression.
20219412 Observational study of gene-disease association. (HuGE Navigator)
20207476 role of OPN in prostate cancer PC-3 cells; study demonstrated OPN knockdown could downregulate MMP-2 and MMP-9; IKK-2 may play a crucial role in OPN-induced MMP-2 and MMP-9 expressions via NF-kappaB-mediated signaling pathways
20155457 OPN may play an important role in the growth and invasion of human renal cancer ACHN cells, and these processes are correlated with the activations of MMP-2 and MMP-9.
20150368 osteopontin may play important roles in regulating cell invasion in glioma cells
20144595 The -156 delG/G polymorphism of osteopontin gene could serve as a candidate genetic marker used to evaluate the risk of calcium urolithiasis.
20144595 Observational study of gene-disease association. (HuGE Navigator)
20138033 Plasma OPN level is correlated with the severity of liver fibrosis and inflammation, suggesting OPN could be used as a biomarker to evaluate the severity of liver damages in hepatitis C subjects.
20131968 Osteopontin is characterized as a biomarker for malignant mesothelioma in human
20109337 Tirapazamine can down-regulate hypoxia-induced expression of HIF-1alpha and OPN mRNA of HNE-1 cells and radiosensitize the HNE-1 cells but not CNE-1 cells.
20101228 OPN is involved in multidrug resistance by enhancing the CD44 binding to HA.
20086024 Suggest that bone-related molecules like osteopontin and vitamin D with important immunomodulatory functions are related to the immunoglobulin G index in relapsing-remitting multiple sclerosis patients.
20085934 elevated plasma osteopontin levels are associated with resection of non-small-cell lung cancer.
20075512 Variation in the OPN gene (at three single nucleotide polymorphisms:rs11730582, rs11728697 and rs4754) might be significantly associated with sarcoidosis and the TTT haplotype in OPN may act as a protective factor in sarcoidosis.
20074733 osteopontin has a role in severity of coronary and aortic atherosclerosis
20071328 OPN is highly susceptible to cleavage near its integrin-binding motifs, and the protein is a novel substrate for plasmin and cathepsin D
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20038306 The expression of OPN and B7-H4 increased in epithelial ovarian cancer.
20037822 OPN and its receptor integrin alphanubeta3 may be involved in the pathogenesis of preeclampsia.
20022267 Our findings indicated that higher OPN expression is a potential biomarker to predict survival in patients with urothelial carcinoma of the upper urinary tract
20019453 Association may exist between coronary artery calcification and plasma osteopontin levels.
20019131 OPN could play a role in the formation of calcifications that often are associated with breast cancer
20008129 OPN is abundantly expressed by both effector T cells and keratinocytes in allergic contact dermatitis lesions.
20007708 Results demonstrate that cell interaction, TLR4 activation, and high glucose up-regulate osteopontin expression, and adipocyte-derived IL-6 played a major
20004120 Serum osteopontin was significantly down-regulated in carotid artery stenosis treated with combined carotid artery stenting and intensive lipid-lowering therapy.
19952401 The expression of OPN protein and mRNA was up-regulated by FGF-2 in A549 cells.
19948844 Vitamin D receptor agonists induce a procalcific to anticalcific paracrine switch in macrophages via osteopontin up-regulation.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19901966 This work has shown for the first time that IFITM3 physically interacts with OPN and reduces OPN mRNA expression
19887478 osteopontin has a role in relapse-free survival of melanoma
19885563 OPN splice variants differentially couple to signaling pathways to modulate the migratory property of hepatocellular carcinoma
19854170 This study demonstrates that adhesion of isolated neonatal rat osteoclasts in vitro was augmented on bovine milk osteopontin (bmOPN) with post-translational modifications (PTMs) compared to human Escherichia-coli-derived recombinant OPN without PTMs.
19850036 OPN promotes prostate cancer cell progression processes by activating the Akt/beta-catenin pathway. The OPN/Akt pathway is required for the stabilization of beta-catenin. Nuclear beta-catenin activates the TCF/LEF family of transcription factors.
19834535 Observational study of gene-disease association. (HuGE Navigator)
19813107 Loss of p16(INK4) was significantly associated with osteopontin overexpression Patients with osteopontin (-) and with p16(INK4) (+) lived longer than patients with osteopontin (+) and with p16(INK4) (-).
19806573 Gene silencing of osteopontin inhibited cell invasion and promoted apoptosis.
19805619 siRNA-mediated knockdown of OPN expression induces cell death in both AML blasts and CD34(+)CD38(-)CD123(+) leukemic progenitors.
19804447 Osteopontin is likely to contribute to the process of angiogenesis observed in the airways in asthma.
19798549 critical roles in force-induced OPN expression in hPLFs through interaction with Rho/ROCK as upstream effectors and ERK-Elk1/ERK-c-Fos as downstream effectors.
19790060 Thrombin activation of osteopontin (OPN) (resulting in OPN-R) and its subsequent inactivation by thrombin-activatable carboxypeptidase B (generating OPN-L) occurs locally within inflamed joints in rheumatoid arthritis.
19784742 Results demonstrate that osteopontin is widely distributed in normal human cells, particularly those comprising the central and peripheral nervous systems.
19783881 Higher initial serum OPN levels were associated with a large tumor, portal vein invasion, and an advanced tumor stage.
19781269 High serum levels and high mRNA expression of Gal-3 and OPN in non-small cell lung cancer are closely related to the occurrence and metastasis of NSCLC.
19780053 The expression levels of four of the up-regulated genes, CXCL1, SPARC, SPP1 and SULF, were significantly higher in the cancerous tissue compared with the normal tissue (fold change 3.4-8.9).
19767100 OPN is one of the downstream mediators of aberrantly activated PI3K/AKT signaling by Tax, which may partially contribute to HTLV-1-associated leukemogenesis.
19763701 status of OPN mRNA expression could be a novel prognostic molecular marker for CRC patients
19740309 hypoxic DC secreted large amounts of osteopontin, which were responsible for the enhanced migration of tumour cells
19720619 patients with COPD have increased OPN expression within distal airways in association with clinical airway obstruction
19706414 Intracellular cleavage of osteopontin by caspase-8 modulates hypoxia/reoxygenation cell death through p53.
19694703 Osteopontin may have a potential use as a diagnostic factor for cervical cancer and osteopontin expression is closely correlated with carcinogenesis and invasion of cervical cancer
19638732 plasma osteopontin has a role in immune activation during HAART and HAART-induced side effects
19634115 plasma OPN levels do not discriminate between chronic inflammatory and malignant lung diseases
19609945 This is the first demonstration that OPN inhibition blocks glioma tumor growth.
19609729 osteopontin nd beta-catenin are useful in differentiating small cell lung carcinomas and non-small cell lung carcinomas
19603104 Osteopontin (OPN) levels were significantly (P < 0.05) higher in Rheumatoid arthritis (RA) patients (median 9.93, range 4.36-47.80 ng/mL) than in systemic sclerosis (SSc) patients (4.3, 2.1-19.7 ng/mL) or controls (5.2, 4.1-9.4 ng/mL).
19602039 found that OPN could activate MMP9 and upregulate MMP2
19601999 polymorphism in TGFBR2 are associated with altered secretion of OPN, supporting a role for transforming growth factor beta in OPN production.
19597469 OPN enhances angiogenesis directly through PI3K/AKT- and ERK-mediated pathways with VEGF acting as a positive feedback signal.
19593583 Data show that the preoperative plasma OPN level and serum AFP level in patients with early stage of HCC can be used as a prognostic marker for early stage of HCC.
19581305 OPN and its polyaspartate sequence affect calcium oxalate dihydrate mineral growth.
19573311 High expression of integrin beta3 and OPN in ectopic endometrium of adenomyosis may cause endometriotic lesions.
19565503 There is a unique role of osteopontin in leukocyte migration, in the context of perpetuation of rheumatoid synovitis through the induction of MCP-1 and MIP-1beta.
19562270 overexpression of OPN in human embryo kidney-293 cells significantly increases both the level of cell proliferation, by provoking the G(1)/S transition, and the level of cell migration in vitro.
19556240 The observations conclude that the GLI1-mediated up-regulation of OPN promotes malignant behavior of cancer cells.
19549529 Cyclooxygenase-2 inhibitors down-regulate osteopontin and Nr4A2-new therapeutic targets for colorectal cancers.
19538464 hsa-mir-299-5p targets OPN.
19528482 Elevated osteopontin is associated with malignant pleural mesothelioma.
19476604 While pleural fluid and pleural fluid/serum osteopontin were higher in patients with malignancies, the diagnostic accuracy of the tests was not sufficient to permit routine use in clinical practice.
19475568 OPN enhances the migration of chondrosarcoma cells by increasing MMP-9 expression through the alphavbeta3 integrin, FAK, MEK, ERK and NF-kappaB signal transduction pathway.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19400906 The Osteopontin plays a role in the migration of eosinophils into the airways and may be involved in the pathogenesis of asthma.
19399415 There was a significant correlation between the expression of p-STAT3 and that of osteopontin in melanoma.
19376608 Correlation of OPN protein expression and bone metastasis in non-small-cell lung cancer needs further investigation.
19369471 Hypoxic synovial monocytic cells are a likely source of VEGF and OPN in juvenile idiopathic arthritis.
19366056 osteopontin evaluation in breast cancer patients can be a particularly interesting method of research in staging of the disease as well as in the prognosis
19365701 Plasma OPN levels may be predictive of coronary calcification, suggesting an important role of OPN in the atherosclerotic calcification pathogenesis.
19359522 OPN overexpression was associated with interstitial lung diseases.
19346516 Polymerization of OPN generates a novel alpha9beta1-binding site and that the interaction of this site with the alpha9beta1 integrin is critical to the neutrophil chemotaxis induced by polymeric OPN.
19340392 These findings suggest that OPN is associated with the occurrence of Lewy body disease and SNP-66 may be a susceptibility factor.
19340392 Observational study of gene-disease association. (HuGE Navigator)
19339987 In women, the association between rs9138 C and higher serum OPN and IFN-alpha was restricted to younger subjects, and risk allele carriers showed a strong age-related genetic effect of rs9138 genotype on both serum OPN and IFN-alpha.
19339987 Observational study of gene-disease association. (HuGE Navigator)
19337795 Osteopontin protects against cardiac ischemia-reperfusion injury through late preconditioning.
19301019 in peripheral blood mononuclear cells and in skin biopsies of psoriatic patients
19287188 SPP1 was significantly higher expressed in palate tissue from patients with cleft lip and/or palate compared to cleft palate and immunostaining in palatal shelves against SPP1 in human embryonic craniofacial tissue was positive.
19285954 These findings suggest different functions for SPP1 isoforms and underline pro-tumorigenic properties of isoforms A and B.
19285424 Results suggest that nitric oxide could modulate the initial inflammatory signals that induces the osteopontin over-production with the related cascade of events leading to intimal hyperplasia.
19285028 Mutations on the QLYxxYP motif of hOPN also markedly diminished its activity for lymphocyte activation and migration.
19281985 We here provide evidence that a portion of the OPN locus is likely to associate with cardiovascular disease-related phenotypes.
19281985 Observational study of gene-disease association. (HuGE Navigator)
19260859 expression in endometrial tissue is higher in women with endometriosis than in controls
19246678 Osteopontin: a fibrosis-related marker molecule in cardiac remodeling of enterovirus myocarditis in the susceptible host.
19217889 The data suggest that osteopontin in plasma and synovial fluid is related to progressive joint damage in knee osteoarthritis.
19212618 Osteopontin is a useful prognostic marker in gastric cancer, and combined with CDX2, may have particular advantage for predicting survival of advanced gastric cancer patients.
19208558 Local generation of thrombin-cleaved osteopontin was increased in RA joints. Thrombin-cleaved osteopontin may be a useful biochemical marker of RA.
19184356 This result suggested that osteopontin plays an important role in angiotensin II-induced inflammatory activation in vascular smooth muscle cells.
19138884 Results suggest that SPP1 can play a role as susceptibility gene, possibly by a sex-specific mechanism acting in the autoimmune process.
19138884 Observational study of gene-disease association. (HuGE Navigator)
19076536 The expression of OPN is upregulated in chronic rhinosinusitis (CRS). The mutual regulatory interactions between OPN and inflammatory cytokines suggest that OPN may play an important role in the pathogenesis of CRS.
19048398 High osteopontin is associated with high grade of astrocytomas.
19028408 High plasma OPN levels are an unfavorable factor for development of cardiovascular disease in patients with psoriasis
19023151 In patients undergoing percutaneous coronary intervention, the preprocedural osteopontin (OPN) and C reactive protein (CRP) levels are independent predictors for further cardiovascular events, but not for restenosis.
19017937 Analogous to EAE, in subjects with MS, we found increased expression of Opn in DCs and increased expression of the Opn receptors CD44, beta(3), and alpha(v) on T cells.
19016748 OPN promotes ovarian cancer progression and cell survival and increases HIF-1alpha expression through the PI3-K/Akt pathway.
19014781 Tumor-associated OPN can serve as an indicator of tumor regrowth.
19010864 a significant increase in osteopontin and MMP-9 levels and activity in patients with prostate cancer
19010227 Expression of both OPN and CD44s in hepatocellular carcinoma is associated with advanced tumor stage and contributes to prognosis information.
18997126 Osteopontin combined with CD44 is a promising independent predictor of tumor recurrence and survival in hepatocellular carcinoma patients.
18996613 OPN contributs to the migration of lung cancer cells
18972404 Osteopontin (OPN) plays an important role in metastasis as well as tumor growth of hepatocellular, in which different minimum threshold levels of OPN are needed.
18952835 Data show that hepatic OPN expressions were related to insulin resistance and steatosis, suggesting their local implication in the progression of liver injury.
18949741 analysis of osteopontin expression according to molecular profile of invasive breast cancer
18807011 Serum levels of osteopontin are increased in systemic inflammatory response syndrome and sepsis
18787423 Immuno-localization of CD44 and osteopontin in developing human kidney.
18722093 Endothelin signaling axis activates osteopontin expression through PI3 kinase pathway in A375 melanoma cells.
18701136 Overexpression of osteopontin independently correlates with vascular invasion and thus predicts poor survival for patients with hepatocellular carcinoma.
18694758 Results describe the crystal structure of monoclonal antibody 23C3 in complex with its osteopontin epitope peptide.
18694621 Osteopontin small interfering RNA may offer a new potential gene therapy approach for human gastric cancer.
18682895 Results suggest that centrifugal force up-regulates type I collagen and osteopontin expression in human gingival fibroblasts, and that ERK and JNK play indispensable roles.
18676742 CST6, CXCL14, DHRS3, and SPP1 are regulated by BRAF signaling and may play a role in papillary thyroid carcinoma pathogenesis
18670302 Elevated osteopontin serum levels are associated with malignant mesothelioma.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18651220 Expression of osteopontin in centroacinar cells in chronic pancreatitis with calcification and in autoimmune pancreatitis is significantly greater than in normal pancreas.
18629582 Osteopontin is associated with esophageal tumorigenesis and progression, but not patients' survival.
18627421 Data demonstrate that in patients with active Crohn's disease OPN serum concentration correlated significantly with disease activity.
18616394 This study showed that plasma levels of osteopontin are significantly correlated with HIV-induced CNS dysfunction, and suggested that the development of interventions to modulate osteopontin production or signaling might be beneficial.
18593988 osteopontin and IL-8 may have roles in prostate neoplasm recurrence
18563556 Genes more highly expressed in BRCA1-associated tumors included stathmin, osteopontin, TGFbeta2 and Jagged 1
18550471 Osteopontin expression was significantly lower in long-term compared with short-term survivors of malignant pleural mesothelioma (P< .0001), and overall survival analysis showed that low osteopontin expression was associated with longer survival.
18549897 RNA stability is a new, previously unrecognized mechanism that regulates osteopontin expression in hepatocellular carcinoma to convey metastatic function.
18549690 osteopontin:alpha(v)beta(3)integrin complex untenable as marker of endometrial receptivity and implantation potential
18537194 Novel pathway by which OPN and possibly other Ets-1 target genes involved in tumor metastasis are regulated by TIP30. Mechanism for metastasis promoted by TIP30 deficiency.
18524812 Data show that mRNA expression of OPN was significantly increased throughout the window of implantation.
18508510 Opn has pivotal role in cell adhesion, chemotaxis, prevention of apoptosis, invasion, migration and anchorage-independent growth of tumor cells. [REVIEW]
18493866 The overexpression of osteopontin protein in astrocytoma cells suggests its role in astrocytoma progression and angiogenesis.
18480255 osteopontin alternative translation generates intracellular and secreted isoforms that mediate distinct biological activities in dendritic cells
18474739 Osteopontin in the cerebrospinal fluid may be, in part, of central nervous system origin, and may play an important role in central nervous system inflammation.
18470911 OPN downregulation by BRMS1 may be responsible, at least in part, for BRMS1-mediated metastasis suppression by sensitizing cancer cells to stress induced apoptosis.
18459127 Functional -443T/C osteopontin promoter polymorphism is associated with melanoma metastases.
18443355 Opn plays an important role in the development of albuminuria, possibly by modulating podocyte signaling and motility
18442196 The most overexpressed gene in intrahepatic cholangiocarcinoma is the gene encoding osteopontin.
18413297 OPN is a bona fide substrate for thrombin, and generation of thrombin-cleaved OPN with enhanced pro-inflammatory properties provides a molecular link between coagulation and inflammation
18410276 studied gene expression profile of brain lesions of a patient with Neuromyelitis optica by using DNA microarray; found marked up-regulation of interferon gamma-inducible protein 30 (IFI30), CD163, and secreted phosphoprotein 1 (SPP1, osteopontin)
18406574 Observational study of gene-disease association. (HuGE Navigator)
18396783 Compared with normal pregnancy, osteopontin expression and decidual killer cells accumulation were reduced significantly in recurrent pregnancy loss patients.
18393978 osteopontin expression is elevated in ovarian clear cell carcinoma
18388057 Osteopontin levels are elevated in patients with peripheral arterial disease.
18353318 Infertile women with isolated polycystic ovaries are deficient in endometrial expression of osteopontin but not alphavbeta3 integrin during the implantation window.
18335026 osteopontin is associated with SLE, and this association is especially stronger in males. To our knowledge, this report serves as the first association of a specific autosomal gene with human male lupus
18335026 Observational study of gene-disease association. (HuGE Navigator)
18317949 haplotypes of OPN gene contributed to determining risk factors as well as protective factors of large artery atherosclerosis.
18317949 Observational study of gene-disease association. (HuGE Navigator)
18210878 Osteopontin over-expression is considerably correlated with lymph node metastasis in non-small cell lung cancers.
18210151 plasma osteopontin levels are potentially useful as a diagnostic and prognostic biomarker for cervical cancer.
18197854 production is associated with the inflammatory process of oral lichen planus development
18181047 Osteopontin, cyclooxygenase-2 and vascular endothelial growth factor synergically promote angiogenesis and metastasis in gastric cancer.
18178454 Demonstrated elevated serum OPN and OPG levels in patients with carotid stenosis and documented an independent association between these biochemical markers, pathology and carotid-induced symptomatology.
18174176 osteopontin (OPN) is highly expressed and secreted by erythroblasts during differentiation
18167187 Observational study of gene-disease association. (HuGE Navigator)
18167187 OPN gene 9250 polymorphism appears to be associated with susceptibility to SLE in Chinese Han ethnic population.
18162078 Real-time PCR showed that ETOH significantly altered the expression of genes involved in cell adhesion. There was an increase in the expression of alpha and beta Laminins 1, beta Integrins 3 and 5, Secreted phosphoprotein1 and Sarcoglycan epsilon.
18160829 Results show that OPN is not valuable as a clinical marker for monitoring the treatment response in multiple myeloma patients because of inconsistency in its levels in multiple myeloma patients.
18158320 syndecan-4 is a critical intrinsic regulator of inflammatory reactions via its effects on OPN function
18155656 These are the first data to suggest a role for osteocytes and OPN in the recruitment of mesenchymal stem cells to aid in fracture repair.
18085382 Osteopontin as well as dystrophy within the tumor may be involved in the stromal calcification of large cell neuroendocrine carcinoma.
18079410 OPN is required for the differentiation and activity of myofibroblasts formed in response to the profibrotic cytokine transforming growth factor-beta1.
18072945 phosphorylation and glycosylation sites and N-terminal fragments present in urine are generated by proteolytic cleavage
18053633 specific recognition of membrane-bound Osteopontin sites on preosteogenic cell membrane
18048491 Osteopontin expression in adipose tissue macrophages was strongly up-regulated by obesity.
18037740 Osteopontin expression of circulating CD4+ T cells and plasma osteopontin levels reflect the severity of heart failure.
18004082 Osteopontin protein expression was confirmed as a new independent predictor of tumor recurrence and poor prognosis in patients with gastric cancer.
17987038 Finding identify OPN and CD44v6 as predictive markers of recurrence or aggressiveness in laryngeal intraepithelial neoplasia, and overall, point out an important signalling complex in the evolution of laryngeal dysplasia.
17960616 overexpression of Osteopontin-c is associated with invasive, but not in noninvasive, breast tumor
17938278 These data suggest that OPN is associated with keratinocyte differentiation and that it is expressed in AK and SCC, which have metastatic potential, but minimally expressed in solid BCC.
17898038 Whole urine from osteopontin, Tamm-Horsfall protein , or double-null mice all possessed a dramatically reduced ability to inhibit the adhesion of calcium oxalate monohydrate crystals to renal epithelial cells
17896150 Increased expression of osteopontin is associated with gastric carcinoma
17884775 Osteopontin gene 9250 polymorphism appears to be associated with the susceptibility to lupus nephritis in southern Chinese Han population.
17884775 Observational study of gene-disease association. (HuGE Navigator)
17852826 Reference intervals were established with a high analytic performance for OPN and an acceptable analytic performance for OPG and total sRANKL. The study revealed low biological variation for OPN and total sRANKL and high biological variation for hsCRP.
17848618 ING4 suppression in MM cells up-regulated IL-8 and OPN, increasing the HIF-1alpha activity and its target gene NIP-3
17721886 REVIEW of multi-faceted functional role of OPN in breast cancer, in particular the malignancy-promoting aspects of OPN
17706953 OPG but not OPN stimulated a dose-dependent increase in the expression of intercellular adhesion molecule-1, vascular cell adhesion molecule-1 and E-selectin by endothelial cells in the presence of TNF-alpha
17696803 OPN is involved in mediating hepatic inflammation and the ensuing liver toxicity --REVIEW
17689681 In SW480 human colon cancer cells, we conclude that Sp1 mediated expression of the tumor metastasis protein, OPN, regulates in vitro functional correlates of tumor metastasis
17620367 Data indicate that therapeutic targeting of tumor OPN molecules could reset metastatically relevant gene networks, resulting in clinical benefit.
17595250 Plasma OPN and mRNA expression of OPN in omental adipose tissue are increased in overweight/obese patients.
17565744 OPN (osteopontin) is a transcriptional target of aberrant Wnt signaling, and OPN expression alone predicts survival in human colon cancer.
17548669 the possible mechanisms by which osteopontin may contribute functionally to malignancy, particularly in breast cancer {Review}
17545592 Macrophage-derived OPN can compensate for the decrease of OPN and thereby restore the metastatic potential of OPN-knockdown tumor cells.
17519954 Observational study of gene-disease association. (HuGE Navigator)
17519954 significant association of two haplotypes located in the OPN promoter with the relative probability of nephrolithiasis; one of increased and one of reduced risk
17496055 Observational study of gene-disease association. (HuGE Navigator)
17496055 Findings suggest that SPP1 polymorphisms might be among the genetic factors for HBV clearance and/or HCC occurrence.
17493236 Frequent osteopontin expression is typical of, but not specific for malignant pleural mesothelioma, whereas it appears to select pulmonary adenocarcinoma cases with p65 and MMP-9 expression, suggesting a link with EGFR signalling pathways.
17482311 OPN plays a crucial role for tumor growth and angiogenesis of human lung cancer cells in vivo by interacting with alphavbeta3 integrin.
17482182 Osteopontin was found more prominently in glandular epithelium than in interstitial space of the endometrium.
17464350 These data confirm the positive role of OPN in gastric-cancer-associated angiogenesis.
17452979 Increased expression of an osteopontin splice variant was associated with metastatic hepatocellular carcinoma
17444956 OPN-stimulated IL-10 production increases less in T-cell cultures from Crohn's disease (CD) patients than from healthy controls, indicating that IL-10 deficiency may be involved in the defective immune-regulation in CD.
17441427 The expression of CTGF and/or OPN might be important biological markers in reflecting the progression, biological behavior, metastatic potential and prognosis of laryngeal squamous cell carcinoma.
17439891 Observational study of gene-disease association. (HuGE Navigator)
17439891 that the 795 polymorphism does not play an etiological role per se in multiple sclerosis
17418101 Thus, erythrocytes may be specialized cells for storing and supplying plasma S1P.
17384004 Observational study of gene-disease association. (HuGE Navigator)
17369493 demonstrated the role of OPN in two distinct aspects of macrophage accumulation: prevention from recirculation and protection from apoptosis
17360982 Treatment of human macrophages with the PPARalpha ligands bezafibrate or WY14643 inhibited OPN expression and transcription.
17343740 A possible role of OPN and its receptor(s)is mediating downstream signals in the progression of prostate cancer cells. OPN over expression increases the interaction of CD44 and MMP-9 on the cell surface.
17332338 OPN-CD44(V) interaction promotes ECM-derived survival signal mediated through integrin activation, which may play an important role in the pathogenic development and progression of gastric cancer.
17316167 The immunocytochemical localization of OPN in the cytoplasm of pyramidal neurons. In AD brains, there was a significant 41 % increase in the expression of neuron OPN compared with age-matched control brain.
17289872 Osteoclast-derived osteopontin and VEGF from myeloma cells cooperatively enhance angiogenesis and also induce osteoclastogenic activity by vascular endothelial cells
17253181 The expressions of G3BP and OPN proteins have a close relationship with lymphoid metastasis and survival in esophageal squamous carcinoma patients.
17245215 The plasma concentrations of OPN are elevated in patients with ulcerative colitis and that OPN expression is correlated with clinical activity.
17244457 Osteopontin might enhance the expression of MMP-2 and uPA to promote malignant phenotypes of SMMC-7721 cells.
17227585 Osteopontin a tumor-metastasis activator, a crucial downstream target of Breast cancer metastasis suppressor 1 is identified.
17189522 Data suggest that transglutaminase 2 interactions with osteopontin lead to protein polymerization that facilitates macrophage adhesion to the calcified elastic lamellae to promote clearance of the ectopic mineral deposits.
17188882 OPN is involved in Parkinson disease-associated neurodegeneration
17170369 Observational study of gene-disease association. (HuGE Navigator)
17130676 Review. Osteopontin plays a role in Th1 and IgE-mediated immune responses.
17110905 Increased blood levels in smokers with type 2 diabetes.
17044113 OPN is produced in osteolytic lesions: MM-derived OPN plays a critical role in bone disease by protecting bone from destruction.
17022822 Expression of SPP1 in osteosarcoma is associated with an inflammatory response and bone remodeling, making it a good biomarker.
17005603 Intranuclear OPN participates in the process of cell duplication and associates with Plk1.
16962083 The presence of OPN in the normal human and non-human primate SN coupled to its decreased expression following nigral cell degeneration suggests that it may play an important role in dopaminergic neurone survival.
16880782 The evaluation of Osteopontin expression is useful for predicting the malignant properties of esophageal squamous cell carcinoma.
16830223 We found that the expression of OPN corroborates with the aggressive phenotype of the breast cancer cells i.e. the expression of OPN is acquired as the breast cancer cells become more aggressive.
16817793 hyperphosphatemia or azotemia is associated with the expression of osteopontin in vascular smooth muscle cells in patients with ESRD
16807238 OPN-transfected cells express high levels of hyaluronan synthase 2, which is associated with increased HA production and matrix retention and is necessary for tumor cell adhesion to bone marrow endothelial cells and anchorage-independent growth
16797773 Real-time RT-PCR confirmed up-regulation of IL-8, osteopontin, and TNFRSF14 and down-regulation of SAMeS and CD209 in AH.
16786357 High Osteopontin is associated with hepatocellular carcinoma
16765311 results suggest that OPN might suppress multiplication of Plasmodium falciparum through T helper 1 cells-mediated immune responses
16741188 Observational study of gene-disease association. (HuGE Navigator)
16633066 study shows the expression pattern of osteopontin in cellular populations of normal endometrium and in endometrial carcinoma and its correlation with the expression of CEACAM1
16632752 has a pivotal role in the development of immune responses and in the tissue destruction and the subsequent repair processes associated with inflammatory diseases
16614705 Protein kinase B (Akt) gene regulated osteopontin expression at the RNA level and protein level.
16571650 OPN acts downstream of PI3K in melanoma and PTEN loss contributes to melanoma development
16533775 High osteopontin expression is associated with non-small cell lung cancers
16512757 Observational study of gene-disease association. (HuGE Navigator)
16489073 Results suggest osteopontin is dependent on ERalpha for its expression.
16433860 Observational study of gene-disease association. (HuGE Navigator)
16428483 Elevated osteopontin in urine is associated with ovarian cancer
16424021 osteopontin contributes to several steps in the process of prostate carcinogenesis and metastasis
16373617 high plasma levels of OPN in patients with a history of percutaneous coronary intervention were associated with the presence of restenosis, suggesting that OPN may play a role in the development of restenosis after percutaneous coronary intervention
16331611 increased OPN level may be involved in the malignant transformation of prostate epithelial cells and OPN expression level is an important determinant for patient survival
16299231 Results identify osteopontin as a marker and a potential therapeutic target in cases of aggressive laryngeal squamous cell carcinomas.
16208410 silencing Runx2 with siRNA in myeloma cells suppressed OPN mRNA and protein expression, critical for the proangiogenic effect of myeloma cells
16204248 TIS7, a negative regulator of transcriptional activity, represses expression of OPN and beta-catenin/Tcf-4 target genes
16166420 Results support the hypothesis of an association between high osteopontin expression and poor survival of patients with stage I non-small cell lung cancer, suggesting that osteopontin could be a candidate target for cancer therapy.
16145474 Observational study of gene-disease association. (HuGE Navigator)
16145474 Polymorphism at position 9,402 of the OPN gene is highly associated with urinary calcium stones, whereas polymorphism at position 9,171 of the OPN gene is not associated with urinary calcium stone disease.
16136472 localizes with the follicular dendritic cell (FDC) network in lymphatic tissues in HIV-1 infection and has a role in lymphoid follicle pathology and repair and B cell regulation
16100012 SPP1 mRNA increases during acute lung injury in mice
16047475 These data suggest that nitric oxide enhances hepatocellular cancer expression of OPN and, as a result, conveys a metastatic phenotype.
16009426 Three promoter polymorphisms of the human Eta-1 gene, -443T/C, -156delG/G, -66T/G, were investigated for possible influence on gene expression.
16005200 integrin alphavbeta6, alphavbeta3, alphavbeta5, alpha5beta1 and alpha9beta1 binding to osteopontin is controlled by specific structural motifs that are recognized by extracellular proteases
16000556 Osteopontin overexpression is common in primary non-small cell lung cancer (NSCLC) and may be important in the cancer development and progression and osteopontin plasma levels may serve as a biomarker for diagnosing or monitoring patients with NSCLC.
15998773 CD44 and/or OPN may be molecular targets for therapeutic intervention in aggressive papillary thyroid carcinomas.
15998376 Granular cell tumor among Schwannian cell tumors consistently express OPN, but its biological significance requires further investigation.
15993098 Overall these results show that OPN is deregulated by BCR-ABL oncogene and suggest that OPN could be involved in CML stem cell biology.
15970685 Increase in osteopontin is associated with pancreatic cancers and chronic pancreatitis
15956076 OPN and CEACAM1 may act as a functional complex involved in the regulation of placental invasiveness.
15954903 osteopontin is one of the crystal-associated urine proteins involved in the formation of the organic layers of the plaque particles in kidney stones
15949549 OPN has a role in foreign body giant cell formation in response to implantation
15885319 Observational study of gene-disease association. (HuGE Navigator)
15885319 Osteopontin (OPN) genotypes may influence multiple sclerosis development and progression due to their influence on OPN levels.
15868370 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15868370 SNPs in the promoter region of the osteopontin gene as a marker predicting the efficacy of interferon-based therapies in patients with chronic hepatitis C.
15863395 Circulating levels of osteopontin, but not IFN-gamma or IL-12, reflect disease activity in patients with tuberculosis.
15857938 ability of Bcr-Abl to stimulate the expression of OPN
15855273 identify OPN as an important tissue-derived factor that DCs encounter when traveling from peripheral sites of activation to secondary lymphatic organs, which induces DC maturation toward a Th1-promoting phenotype
15845635 up-regulation of OPN expression by interlobular biliary epithelium in biliary atresia, which correlates with biliary proliferation and portal fibrosis
15776015 Even though the role of osteopontin in the cytopathogenesis of atypical teratoid/rhabdoid tumor still needs to be determined, data support that overexpressed osteopontin is a potential diagnostic marker for atypical teratoid/rhabdoid tumor.
15761492 Data show that mRNA expression of osteopontin (OPN) was elevated in CD4(+) synovial T cells derived from patients with rheumatoid arthritis, which correlated with increased OPN concentrations in synovial fluid (SF).
15744522 Observational study of gene-disease association. (HuGE Navigator)
15742430 Observational study of gene-disease association. (HuGE Navigator)
15742429 Observational study of gene-disease association. (HuGE Navigator)
15731245 Rotavirus infection of intestinal epithelial cells caused marked increases in OPN mRNA levels and secreted OPN protein
15712659 OPN was higher in proliferated bile ductules of acute-form fulminant hepatitis than in cirrhotic and normal liver bile ducts. OPN in proliferated bile ductules was decreased in subacute form of fulminant hepatitis.
15696579 highly phosphorylated human OPN-1 can stimulate trophoblastic cell migration and provides evidence for the involvement of the PI3K/mTOR/p70 S6 kinase pathway in the JAR cells response
15692970 Observational study of gene-disease association. (HuGE Navigator)
15579312 analysis of osteopontin peptides and their roles in cell adhesion
15501463 Molecular structure of OPN, evidence for its functional role in tumor cell metastasis, downstream signals that activate invasive mechanisms, and recent reports concerning regulation of OPN transcription [review]
15494684 Review. OPN's role in bone and its role in adhesion, migration, cell survival, and tumorigenesis.
15479859 osteopontin promoter polymorphisms affect its transcriptional activity
15389974 Data demonstrate that early down-regulation of osteopontin in vitro inhibits human osteoclastogenesis.
15167446 Observational study of gene-disease association. (HuGE Navigator)
15101999 Decreased expression of OPN is considered to be a reliable indicator of tumor aggressiveness and clinical outcome in patients with intrahepatic cholangiocarcinoma.
15019804 Osteopontin is expressed at high concentrations in secretory endometrium in epithelial cells and in decidua in stromal cells. Decidual stromal expression of osteopontin is up-regulated by decidualization.
15014008 The large increase in OPN expression in tumors compared with normal tissue and its association with survival suggest a role for OPN in lung tumorigenesis.
15004750 Observational study of gene-disease association. (HuGE Navigator)
15003892 Myeloma cell lines adhere to OPN, so high stromal OPN expression may be partly responsible for retention of myeloma cells in bone marrow. The high plasma OPN levels may be due to OPN production by tumor cells & tumor-induced production by non-tumor cells.
14996707 Notch1 gene expression was decreased 5-fold in osteopontin-treated CD34+ cells
14990565 Beta-catenin, Lef-1, Ets transcription factors, and the AP-1 protein c-Jun each weakly enhanced luciferase expression from an OPN promoter.
14988426 Nurr1 activates the OPN promoter directly in osteoblastic cells and may have a role in the regulation of bone homeostasis
14716823 Epidermal growth factor may regulate osteopontin gene expression through PI3K signaling pathway in hepatocellular carcinoma cells
14706653 Observational study of gene-disease association. (HuGE Navigator)
14706653 OPN promoter region SNP at nt -433 may be a useful marker reflecting hepatitis activity in chronic hepatitis C patients.
14704150 induces alpha(v)beta(3) integrin-mediated AP-1 activity and urokinase type plasminogen activator secretion by activating c-Src/EGFR/ERK signaling pathways
14592838 Subjects carrying haplotype B and/or C had an 8-fold higher risk of developing Dianzani autoimmune/lymphoproliferative disease than haplotype A homozygotes.
14563350 Opn is among the most abundantly expressed proteins in a range of lung diseases and has been shown to regulate aspects of pulmonary granuloma formation, fibrosis, and malignancy (review)
14534308 platelet adhesion to osteopontin-coated surfaces requires an agonist-induced exposure of alpha v beta 3-binding sites for this ligand
14524533 OPN is expressed in breast and prostate cancer and has a role in differentiation and activation of osteoclasts
14517343 increased expression of the alpha(v)beta(3) integrin during breast cancer progression can make tumor cells more responsive to malignancy-promoting ligands such as OPN and result in increased tumor cell aggressiveness.
12949055 OPN binds to the alphavbeta3-integrin to increase plasma membrane CD44v6 expression and augment in vitro adhesion to hyaluronate
12939547 In patients with previous anterior wall myocardial infarction(MI) osteopontin is released from heart into coronary circulation in proportion to left ventricular(LV) systolic function and volumes. Osteopontin may be associated with post-MI LV remodeling.
12928913 Observational study of gene-disease association. (HuGE Navigator)
12927044 OPN expression is significantly higher in malignant epithelial sources over normal and benign epithelial sources, but no difference in expression levels is evident between primary tumors with or without metastases.
12879219 Observational study of gene-disease association. (HuGE Navigator)
12842452 study indicates the possibility that osteopontin plays an important role in the pathogenesis of ulcerative colitis via increased immune activity
12771144 first report that osteopontin induces nuclear factor kappaB activity and urokinase secretion by activating phosphatidylinositol 3'-kinase/Akt protein/Ikappab kinase-mediated signaling pathways
12761568 Observational study of gene-disease association. (HuGE Navigator)
12761568 Association with disease course is detectable in patients with at least one wild-type OPN 1284A allele: these patients are less likely to have a mild disease course and are at increased risk for a secondary-progressive clinical type.
12650611 osteopontin as the leading candidate clinical marker derived from a screen of approximately 12,000 named genes.
12650610 Elevated osteopontin (OPN) transcription often correlates with increased metastatic potential of transformed cells, and in several model systems OPN--whether produced by the tumor cells or by stromal cells - has been shown to enhance metastatic ability.
12640447 Osteopontin, which was identified as a lead gene in the signature, was over-expressed in metastatic HCC
12620651 Observational study of gene-disease association. (HuGE Navigator)
12606946 OPN-induced migration of mammary epithelial cells also requires activation of the EGF pathway. EGF & OPN synergistically induced cell migration. Exogenous OPN increased ligand (TGFalpha> EGF) & EGFR mRNA expression, as well as EGFR kinase activity.
12506143 crystal retention in the human kidney may depend on the expression of CD44-, OPN-, and-HA rich cell coats by damaged distal tubular epithelium.
12456016 in human tumor cells, HGF and M-CSF stimulate osteopontin production (which is subsequently used as a substrate for cell adhesion)
12142743 Results provide the first evidence that osteopontin may play an important role in stone formation in chronic pancreatitis.
11979972 has RGD sequence and role in osteoclast adhesion
11968014 RT-PCR analysis of human bone marrow stromal cells during osteogenesis in vitro: the mRNA levels of bone morphogenetic protein-2 (BMP-2), bone sialoprotein-II (BSP), osteopontin (OP) and cbfa-1 increased with culture time in osteogenic medium.
11940202 Osteopontin was suggested to play a role in HCC, especially in cancer-stromal interactions.
11933203 A silent polymorphism (707C>T, rs1126616) of osteopontin was significantly associated with systemic lupus erythematosus
11928818 Osteopontin modulates prostate carcinoma invasive capacity through RGD-dependent upregulation of plasminogen activators.
11926891 an association between levels of a biomarker, osteopontin, and ovarian cancer suggest its clinical usefulness
11861425 PPARgamma ligands inhibit OPN gene expression through the interference with the binding of nuclear factors to A/T-rich sequence in THP-1 cells.
11854181 OPN induced a profound level of synthesis of IL-12 from noninfected PBMCs. The major cellular source of OPN was monocytes.
11825898 Three SIBLINGs (small integrin-binding ligand, N-linked glycoproteins) enhance factor H's cofactor activity enabling MCP-like cellular evasion of complement-mediated attack.
11807984 The osteopontin gene, which has a role in immunosurveillance, is a direct target of TP53.
11801541 Increased expression is associated with breast tumor metastasis
11787071 mapping of functional epitopes that are important to cell adhesion and migration
11721059 upregulated transcripts in brain of patients with multiple sclerosis

AA Sequence

MRIAVICFCLLGITCAIPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFK      1 - 70
QETLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDL     71 - 140
PATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDITSHMESEELNGAYKAIPVAQD    141 - 210
LNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEFHS    211 - 280
HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN                                        281 - 314
//

Text Mined References (809)

PMID Year Title
26986465 2016 Diagnostic Performance of Alpha-Fetoprotein, Protein Induced by Vitamin K Absence, Osteopontin, Dickkopf-1 and Its Combinations for Hepatocellular Carcinoma.
26840958 2016 Inhibition of Cellular Adhesion by Immunological Targeting of Osteopontin Neoepitopes Generated through Matrix Metalloproteinase and Thrombin Cleavage.
26823725 2015 Osteopontin facilitates invasion in human trophoblastic cells via promoting matrix metalloproteinase-9 in vitro.
26821678 2016 The fibroblast Tiam1-osteopontin pathway modulates breast cancer invasion and metastasis.
26811408 2016 Osteopontin expression is correlated with differentiation and good prognosis in medullary thyroid carcinoma.
26731746 2016 Osteopontin That Is Elevated in the Airways during COPD Impairs the Antibacterial Activity of Common Innate Antibiotics.
26701868 2016 Polycystic ovary syndrome is associated with increased osteopontin levels.
26698858 2015 Baseline Serum Osteopontin Levels Predict the Clinical Effectiveness of Tocilizumab but Not Infliximab in Biologic-Naïve Patients with Rheumatoid Arthritis: A Single-Center Prospective Study at 1 Year (the Keio First-Bio Cohort Study).
26656246 2015 The Effect of Polymorphisms in SPP1 on Risk of Fracture: A Case-Control Study.
26600502 2015 Segment-specific targeting via RNA interference mediates down-regulation of OPN expression in hepatocellular carcinoma cells.
26514514 2015 Diagnostic and Prognostic Roles of Serum Osteopontin and Osteopontin Promoter Polymorphisms in Hepatitis B-related Hepatocellular Carcinoma.
26491674 2015 Osteopontin Involves Cisplatin Resistance and Poor Prognosis in Oral Squamous Cell Carcinoma.
26414945 2016 Serum osteopontin levels in relation to bone mineral density and bone turnover markers in postmenopausal women.
26397192 2015 Overexpression of osteopontin promotes resistance to cisplatin treatment in HCC.
26395740 2016 Glucose-Dependent Insulinotropic Polypeptide Stimulates Osteopontin Expression in the Vasculature via Endothelin-1 and CREB.
26381542 2016 Tumor microenvironment in diffuse large B-cell lymphoma: Matrixmetalloproteinases activation is mediated by osteopontin overexpression.
26369832 2015 OPN gene polymorphisms, rs17524488 GG/G, rs11730582 T/C, and rs9138 C/A, and cancer risk in a Chinese population.
26341976 2015 Osteopontin in Immune-mediated Diseases.
26330178 2015 Associations of MMP-7 and OPN gene polymorphisms with risk of coal workers' pneumoconiosis in a Chinese population: a case-control study.
26280346 2015 Higher Matrix Stiffness Upregulates Osteopontin Expression in Hepatocellular Carcinoma Cells Mediated by Integrin ?1/GSK3?/?-Catenin Signaling Pathway.
26267616 2015 Associations between the Genetic Polymorphisms of Osteopontin Promoter and Susceptibility to Cancer in Chinese Population: A Meta-Analysis.
26234583 2015 The impact of osteopontin on prognosis and clinicopathology of colorectal cancer patients: a systematic meta-analysis.
26210487 2015 Advanced glycation end products accelerate arteriosclerosis after renal transplantation through the AGE/RAGE/ILK pathway.
26203933 One year in review: the pathogenesis of rheumatoid arthritis.
26201095 2015 Schistosome-induced cholangiocyte proliferation and osteopontin secretion correlate with fibrosis and portal hypertension in human and murine schistosomiasis mansoni.
26122937 2015 Plasma osteopontin is a biomarker for the severity of alcoholic liver cirrhosis, not for hepatocellular carcinoma screening.
26111529 2015 Persistently elevated osteopontin serum levels predict mortality in critically ill patients.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26068949 2015 Osteopontin (OPN/SPP1) isoforms collectively enhance tumor cell invasion and dissemination in esophageal adenocarcinoma.
26033745 2015 Osteopontin Promotes Hepatic Progenitor Cell Expansion and Tumorigenicity via Activation of ?-Catenin in Mice.
25973097 2015 Correlation between calcification and bone sialoprotein and osteopontin in papillary thyroid carcinoma.
25973035 2015 Relationship between osteopontin and ?-catenin immunohistochemical expression and prognostic parameters of colorectal carcinoma.
25972323 2015 Osteopontin Regulates VEGFA and ICAM-1 mRNA Expression in Breast Carcinoma.
25972108 2015 Osteopontin, CCL5 and CXCL9 are independently associated with psoriasis, regardless of the presence of obesity.
25963717 2015 mRNA expression levels of hypoxia-induced and stem cell-associated genes in human glioblastoma.
25944164 2015 The role of osteopontin expression in melanoma progression.
25936410 Increased osteopontin in muscle and serum from patients with idiopathic inflammatory myopathies.
25884485 2015 Evaluation of copy number variation and gene expression in neurofibromatosis type-1-associated malignant peripheral nerve sheath tumours.
25875742 2015 Osteopontin: a potential biomarker of Gaucher disease.
25872762 2015 The significance of the co-existence of osteopontin and tumor-associated macrophages in gastric cancer progression.
25866117 2015 Osteopontin Exacerbates Pulmonary Damage in Influenza-Induced Lung Injury.
25862856 2015 Gene expression analysis for evaluation of potential biomarkers in hepatocellular carcinoma.
25839998 2015 Multiple low-affinity interactions support binding of human osteopontin to integrin ?X?2.
25824779 2015 Osteopontin levels in patients with papillary thyroid cancer according to the presence of Hashimoto's thyroiditis.
25809793 2015 CD133+ and Nestin+ Glioma Stem-Like Cells Reside Around CD31+ Arterioles in Niches that Express SDF-1?, CXCR4, Osteopontin and Cathepsin K.
25802196 2015 Plasma osteopontin in acute liver failure.
25796600 2015 Association of SPP1 promoter variants with hip osteoarthritis susceptibility in Chinese population.
25785266 2015 Roles of osteopontin gene polymorphism (rs1126616), osteopontin levels in urine and serum, and the risk of urolithiasis: a meta-analysis.
25760884 2015 Serum osteopontin predicts degree of hepatic fibrosis and serves as a biomarker in patients with hepatitis C virus infection.
25749383 2015 Osteopontin promotes a cancer stem cell-like phenotype in hepatocellular carcinoma cells via an integrin-NF-?B-HIF-1? pathway.
25732057 2015 Interactions between osteopontin and vascular endothelial growth factor: Implications for cancer.
25730089 2015 Multivariate analysis of molecular markers in peripheral blood associated with recurrence and metastasis of hepatocellular carcinoma.
25717047 2015 Secreted Phosphoprotein 1 Promoter Genetic Variants Are Associated with the Response to Pegylated Interferon ? Plus Ribavirin Combination Therapy in Egyptian Patients with Chronic Hepatitis C Virus Infection.
25677682 2015 Targeting osteopontin, the silent partner of Na+/H+ exchanger isoform 1 in cardiac remodeling.
25658639 2015 Glioma-associated microglia/macrophages display an expression profile different from M1 and M2 polarization and highly express Gpnmb and Spp1.
25652109 2015 Diagnostic values of alpha-fetoprotein, dickkopf-1, and osteopontin for hepatocellular carcinoma.
25641372 2015 Genetic modifiers of ambulation in the Cooperative International Neuromuscular Research Group Duchenne Natural History Study.
25625274 2015 Nuclear osteopontin-c is a prognostic breast cancer marker.
25620078 2015 Targeting osteopontin suppresses glioblastoma stem-like cell character and tumorigenicity in vivo.
25600648 2015 Tumor-derived osteopontin reprograms normal mammary fibroblasts to promote inflammation and tumor growth in breast cancer.
25595895 2015 CBX7 and HMGA1b proteins act in opposite way on the regulation of the SPP1 gene expression.
25594638 2015 Plasma osteopontin predicts inflammatory bowel disease activities.
25591760 2015 The OPN gene polymorphism confers the susceptibility and response to Ara-C based chemotherapy in Chinese AML patients.
25578972 2014 Immunocytochemical detection of dentin matrix proteins in primary teeth from patients with dentinogenesis imperfecta associated with osteogenesis imperfecta.
25555465 2015 Osteopontin is a novel prognostic biomarker in early-stage non-small cell lung cancer after surgical resection.
25531371 2014 Increased osteopontin levels in children undergoing venom immunotherapy may serve as a marker of clinical efficacy.
25531323 2015 Osteopontin mediates an MZF1-TGF-?1-dependent transformation of mesenchymal stem cells into cancer-associated fibroblasts in breast cancer.
25490945 2015 Characterization of deposits in patients with calcific tendinopathy of the supraspinatus. Role of phytate and osteopontin.
25480426 2015 Osteocalcin, under-carboxylated osteocalcin and osteopontin are not associated with gestational diabetes mellitus but are inversely associated with leptin in non-diabetic women.
25479069 2014 Serum OPN expression for identification of gastric cancer and atrophic gastritis and its influencing factors.
25476232 2015 Multiple sclerosis and susceptibility to celiac disease: an osteopontin gene haplotypes affair?
25476005 2015 Validation of genetic modifiers for Duchenne muscular dystrophy: a multicentre study assessing SPP1 and LTBP4 variants.
25450502 2015 Site-specific structural characterization of O-glycosylation and identification of phosphorylation sites of recombinant osteopontin.
25449435 2015 Hepatic stellate cells activated by acidic tumor microenvironment promote the metastasis of hepatocellular carcinoma via osteopontin.
25446551 2015 Osteopontin binding to the alpha 4 integrin requires highest affinity integrin conformation, but is independent of post-translational modifications of osteopontin.
25419572 2014 Identification of transglutaminase reactive residues in human osteopontin and their role in polymerization.
25416956 2014 A proteome-scale map of the human interactome network.
25416631 2014 Prognostic information of serial plasma osteopontin measurement in radiotherapy of non-small-cell lung cancer.
25405848 2015 Downregulation of osteopontin enhances the sensitivity of glioma U251 cells to temozolomide and cisplatin by targeting the NF-?B/Bcl?2 pathway.
25400775 2014 Osteopontin promoter polymorphisms at locus -443 are associated with metastasis and poor prognosis of human intrahepatic cholangiocarcinoma in Chinese population.
25380749 2015 Aberrant expression of osteopontin and E-cadherin indicates radiation resistance and poor prognosis for patients with cervical carcinoma.
25378811 2014 Elevated OPN, IP-10, and neutrophilia in loop-mediated isothermal amplification confirmed tuberculosis patients.
25337248 2014 Prognostic and predictive values of SPP1, PAI and caveolin-1 in patients with oral squamous cell carcinoma.
25329616 2014 Association between the hypomethylation of osteopontin and integrin ?3 promoters and vascular smooth muscle cell phenotype switching in great saphenous varicose veins.
25322767 2015 Gene expression of osteopontin in alopecia areata? A case-controlled study.
25290989 2016 Osteopontin expression in healing wounds of horses and in human keloids.
25278703 2014 Osteopontin is an important mediator of alcoholic liver disease via hepatic stellate cell activation.
25277531 2014 Polymorphism -433 C>T of the Osteopontin gene is associated with the susceptibility to develop gliomas and their prognosis in a Chinese cohort.
25271869 2015 Decreased dickkopf-1 levels in chronic lymphocytic leukemia and increased osteopontin levels in non-Hodgkin's lymphoma at initial diagnosis: Could they be playing roles in pathogenesis?
25266800 2015 Association of osteopontin expression with the prognosis of glioma patient: a meta-analysis.
25203751 2015 Gene expression profile analysis of human mesenchymal stem cells from herniated and degenerated intervertebral discs reveals different expression of osteopontin.
25192720 2014 Correlation between ovarian neoplasm and serum levels of osteopontin: a meta-analysis.
25176314 2014 Spatial localization of the JAG1/Notch1/osteopontin cascade modulates extrahepatic metastasis in hepatocellular carcinoma.
25172097 2014 RKIP inhibits gastric cancer cell survival and invasion by regulating the expression of HMGA2 and OPN.
25157961 2014 Energy metabolism during anchorage-independence. Induction by osteopontin-c.
25133167 2014 Serum osteopontin level correlates with carotid-femoral pulse wave velocity in geriatric persons.
25132760 2014 Osteopontin knockdown suppresses the growth and angiogenesis of colon cancer cells.
25128758 2014 Osteopontin - a multi-modal marker and mediator in atherosclerotic vascular disease.
25116355 2014 OPN polymorphism is associated with the susceptibility to cervical spondylotic myelopathy and its outcome after anterior cervical corpectomy and fusion.
25112870 2014 Thrombin cleavage of osteopontin disrupts a pro-chemotactic sequence for dendritic cells, which is compensated by the release of its pro-chemotactic C-terminal fragment.
25109745 2014 Serum anti-osteopontin autoantibody as a novel diagnostic and prognostic biomarker in patients with hepatocellular carcinoma.
25089309 2014 Pulmonary production of osteopontin in humans: effects of left ventricular systolic dysfunction and cardiopulmonary bypass.
25086462 2014 High serum osteopontin levels in pediatric patients with high risk Langerhans cell histiocytosis.
25060796 2014 Osteopontin-CD44v6 interaction mediates calcium deposition via phospho-Akt in valve interstitial cells from patients with noncalcified aortic valve sclerosis.
25046773 2015 Combined DNA methylation and gene expression profiling in gastrointestinal stromal tumors reveals hypomethylation of SPP1 as an independent prognostic factor.
25009318 2014 Genetic association of osteopontin (OPN) and its receptor CD44 genes with susceptibility to Chinese gastric cancer patients.
25009290 2014 PGC-1? induces SPP1 to activate macrophages and orchestrate functional angiogenesis in skeletal muscle.
25007036 2014 Osteopontin: a novel predictor of survival in patients with systemic light-chain amyloidosis.
25000122 2014 Osteopontin O-glycosylation contributes to its phosphorylation and cell-adhesion properties.
24995304 2014 Plasma levels of osteopontin and vascular endothelial growth factor in association with clinical features and parameters of tumor burden in patients with multiple myeloma.
24969575 2014 Osteopontin is a strong predictor of incipient diabetic nephropathy, cardiovascular disease, and all-cause mortality in patients with type 1 diabetes.
24963635 2014 Cell stress induces upregulation of osteopontin via the ERK pathway in type II alveolar epithelial cells.
24950303 2014 Diagnostic significance of serum osteopontin level for pancreatic cancer: a meta-analysis.
24947165 2014 Anti-apoptotic effects of osteopontin through the up-regulation of Mcl-1 in gastrointestinal stromal tumors.
24936586 2014 SPP1 rs9138 variant contributes to the severity of radiological damage in anti-citrullinated protein autoantibody-negative rheumatoid arthritis.
24928493 2014 Osteopontin binds multiple calcium ions with high affinity and independently of phosphorylation status.
24913806 2014 Correlation between OPN gene polymorphisms and the risk of nasopharyngeal carcinoma.
24876663 2014 Assessment of urinary osteopontin in association with podocyte for early predication of nephropathy in diabetic patients.
24831687 2014 Association between secreted phosphoprotein-1 (SPP1) polymorphisms and low bone mineral density in women.
24816798 2014 The prognostic value of osteopontin expression in non-small cell lung cancer: a meta-analysis.
24815020 2014 Expression of osteopontin genotypes (T-4754-C and A-9138-C) in psoriasis and their relation to metabolic syndrome.
24804200 2014 Effect of cyclic mechanical stimulation on the expression of osteogenesis genes in human intraoral mesenchymal stromal and progenitor cells.
24803312 2015 Osteopontin and latent-TGF ? binding-protein 2 as potential diagnostic markers for HBV-related hepatocellular carcinoma.
24758329 2014 Prognostic value of secreted phosphoprotein-1 in pleural effusion associated with non-small cell lung cancer.
24756245 2014 Osteopontin promotes the progression of gastric cancer through the NF-?B pathway regulated by the MAPK and PI3K.
24718314 2014 Osteopontin is induced by TGF-?2 and regulates metabolic cell activity in cultured human optic nerve head astrocytes.
24714122 2014 Osteopontin knockdown inhibits ?v,?3 integrin-induced cell migration and invasion and promotes apoptosis of breast cancer cells by inducing autophagy and inactivating the PI3K/Akt/mTOR pathway.
24700685 2015 Inorganic phosphate induces cancer cell mediated angiogenesis dependent on forkhead box protein C2 (FOXC2) regulated osteopontin expression.
24674683 Is osteopontin involved in cutaneous fibroblast activation? Its hypothetical role in scleroderma pathogenesis.
24626632 2014 Eccentric muscle challenge shows osteopontin polymorphism modulation of muscle damage.
24607407 2014 Osteopontin-CD44 signaling in the glioma perivascular niche enhances cancer stem cell phenotypes and promotes aggressive tumor growth.
24548099 2014 Osteopontin splice variant as a potential marker for metastatic disease in pancreatic adenocarcinoma.
24498405 2014 OPN and ?v?3 expression are predictors of disease severity and worse prognosis in hepatocellular carcinoma.
24498111 2014 Role of hepatitis C virus induced osteopontin in epithelial to mesenchymal transition, migration and invasion of hepatocytes.
24472267 2014 Plasma osteopontin is correlated with bone resorption markers in rheumatoid arthritis patients.
24464486 2014 Osteopontin is a promoter for hepatocellular carcinoma metastasis: a summary of 10 years of studies.
24460294 2013 Overexpressed ostepontin-c as a potential biomarker for esophageal squamous cell carcinoma.
24451146 2014 Assessment of osteopontin in early breast cancer: correlative study in a randomised clinical trial.
24448344 2015 Identification of secreted phosphoprotein 1 gene as a new rheumatoid arthritis susceptibility gene.
24440093 2014 Association of increased osteopontin and splice variant-c mRNA expression with HER2 and triple-negative/basal-like breast carcinomas subtypes and recurrence.
24412090 2014 Osteopontin promotes the invasive growth of melanoma cells by activating integrin ?v?3 and down-regulating tetraspanin CD9.
24400815 2014 Osteopontin and galectin-3 predict the risk of ventricular tachycardia and fibrillation in heart failure patients with implantable defibrillators.
24370940 2014 Serum osteopontin, but not OPN gene polymorphism, is associated with LVH in essential hypertensive patients.
24366422 2014 Combination of osteopontin with peritumoral infiltrating macrophages is associated with poor prognosis of early-stage hepatocellular carcinoma after curative resection.
24355932 2013 OPN gene polymorphism and the serum OPN levels confer the susceptibility and prognosis of ischemic stroke in Chinese patients.
24347266 2014 Tumor-derived microparticles induce bone marrow-derived cell mobilization and tumor homing: a process regulated by osteopontin.
24338767 2014 Serum levels of osteopontin as a prognostic factor in patients with oral squamous cell carcinoma.
24327307 2014 Characterization of UO2(2+) binding to osteopontin, a highly phosphorylated protein: insights into potential mechanisms of uranyl accumulation in bones.
24307429 2014 Serum levels of fetuin-A, osteoprotegerin and osteopontin in patients with coronary artery disease: effects of statin (HMGCoA-reductase inhibitor) therapy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24240095 2013 Mechanism of hepatitis C virus (HCV)-induced osteopontin and its role in epithelial to mesenchymal transition of hepatocytes.
24239954 2013 Pulmonary production of osteopontin in humans: effects of left ventricular systolic dysfunction and cardiopulmonary bypass.
24217817 2014 Increased circulating Th17 cell populations and elevated CSF osteopontin and IL-17 concentrations in patients with Guillain-Barré syndrome.
24215488 2013 Osteopontin is a prognostic biomarker in non-small cell lung cancer.
24212839 2013 Myxovirus resistance, osteopontin and suppressor of cytokine signaling 3 polymorphisms predict hepatitis C virus therapy response in an admixed patient population: comparison with IL28B.
24188933 2014 Osteopontin is an initial mediator of inflammation and liver injury during obstructive cholestasis after bile duct ligation in mice.
24175796 2013 Prognostic value of osteopontin in patients treated with primary radiotherapy for head and neck cancer.
24157812 2014 Osteopontin-a alters glucose homeostasis in anchorage-independent breast cancer cells.
24134522 2013 Monoclonal antibodies targeting the antifibrinolytic activity of activated thrombin-activatable fibrinolysis inhibitor but not the anti-inflammatory activity on osteopontin and C5a.
24129963 2014 Osteopontin has a crucial role in osteoclast-like multinucleated giant cell formation.
24126938 2013 Studies on the role of osteopontin-1 in endometrial cancer cell lines.
24123979 2014 Cord blood levels of osteopontin as a phenotype marker of gestational age and neonatal morbidities.
24120738 2014 Association of osteopontin polymorphisms with nasopharyngeal carcinoma risk.
24084141 2013 Investigation of osteopontin levels and genomic variation of osteopontin and its receptors in Type 1 diabetes mellitus.
24084099 2014 BAFF maintains T-cell survival by inducing OPN expression in B cells.
24071501 2014 Bone sialoprotein and osteopontin in bone metastasis of osteotropic cancers.
24065086 2013 Correlation and prognostic value of osteopontin and Bcl-2 in hepatocellular carcinoma patients after curative resection.
24021319 2013 Expression of integrin ?3 and osteopontin in the eutopic endometrium of adenomyosis during the implantation window.
24012693 2013 Prognostic values of osteopontin-c, E-cadherin and ?-catenin in breast cancer.
24005026 2014 Evaluation of circulating osteopontin levels in an unselected cohort of patients with multiple sclerosis: relevance for biomarker development.
23995733 2014 Serum level of osteopontin as an inflammatory marker does not indicate disease activity or responsiveness to therapeutic treatments in patients with rheumatoid arthritis.
23992637 2014 Osteopontin is associated with decreased apoptosis and ?v integrin expression in lung adenocarcinoma.
23952692 2013 The polymorphisms of osteopontin gene and plasma osteopontin protein levels with susceptibility to colorectal carcinoma.
23910387 2013 Plasma osteopontin levels are associated with disease activity in the patients with multiple sclerosis and neuromyelitis optica.
23900428 2013 An osteopontin promoter polymorphism is associated with aggressiveness in breast cancer.
23891093 2013 Osteopontin and splice variant expression level in human malignant glioma: radiobiologic effects and prognosis after radiotherapy.
23883434 2013 Osteopontin genetic variants are associated with overall survival in advanced non-small-cell lung cancer patients and bone metastasis.
23880208 2013 Circulating osteopontin as a marker of early coronary vascular calcification in type two diabetes mellitus patients with known asymptomatic coronary artery disease.
23875677 2013 Role of osteopontin in differential diagnosis of ovarian tumors.
23867349 2013 OPN -443C>T genetic polymorphism and tumor OPN expression are associated with the risk and clinical features of papillary thyroid cancer in a Chinese cohort.
23793814 2014 Osteopontin expressions correlate with WHO grades and predict recurrence in meningiomas.
23784265 2013 Association between polymorphisms in osteopontin gene (SPP1) and first episode calcium oxalate urolithiasis.
23775819 2013 Molecular profiling of stroma identifies osteopontin as an independent predictor of poor prognosis in intrahepatic cholangiocarcinoma.
23774402 2013 Loss of RUNX3 increases osteopontin expression and promotes cell migration in gastric cancer.
23764959 2013 Serum osteopontin concentration is decreased by exercise-induced fat loss but is not correlated with body fat percentage in obese humans.
23729174 2013 Human and experimental evidence supporting a role for osteopontin in alcoholic hepatitis.
23728336 2014 Hypoxia-driven osteopontin contributes to breast tumor growth through modulation of HIF1?-mediated VEGF-dependent angiogenesis.
23726130 2013 Patterns of metastatic spread in early breast cancer.
23717583 2013 Chemokine (C-C motif) ligand 20, a potential biomarker for Graves' disease, is regulated by osteopontin.
23711950 2013 Osteopontin: a marker for invasive oral squamous cell carcinoma but not for potentially malignant epithelial dysplasias.
23692545 2013 OPN gene polymorphism (Ala250) and lower serum OPN levels are associated with urolithiasis.
23680656 2013 Control of the human osteopontin promoter by ERR? in colorectal cancer.
23675517 2013 Interaction of osteopontin with IL-18 in obese individuals: implications for insulin resistance.
23652051 2013 Osteopontin knockdown suppresses non-small cell lung cancer cell invasion and metastasis.
23636305 2013 Transmembrane receptor CXCR7 increases the risk of extrahepatic metastasis of relatively well-differentiated hepatocellular carcinoma through upregulation of osteopontin.
23619422 2013 Osteopontin-mediated myocardial fibrosis in heart failure: a role for lysyl oxidase?
23619316 2013 Osteopontin up-regulates critical epithelial-mesenchymal transition transcription factors to induce an aggressive breast cancer phenotype.
23614633 2014 Osteopontin gene SNPs (rs9138, rs11730582) mediate susceptibility to external root resorption in orthodontic patients.
23613225 2013 High osteopontin levels predict long-term outcome after STEMI and primary percutaneous coronary intervention.
23589674 2013 Adhesion to osteopontin in the bone marrow niche regulates lymphoblastic leukemia cell dormancy.
23578778 Elevated level of serum osteopontin in school-age children with asthma.
23545719 2013 Expression and localisation of osteopontin and prominin-1 (CD133) in patients with endometriosis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23515922 2013 Osteopontin in bone mineral density of very old Brazilians.
23508392 2014 Elevated expression of connective tissue growth factor, osteopontin and increased collagen content in human ascending thoracic aortic aneurysms.
23441154 2013 Integrative analyses identify osteopontin, LAMB3 and ITGB1 as critical pro-metastatic genes for lung cancer.
23437160 2013 Expression of osteopontin in patients with thyroid dysfunction.
23427088 2013 In vivo overexpression of tissue-nonspecific alkaline phosphatase increases skeletal mineralization and affects the phosphorylation status of osteopontin.
23426449 2013 Osteopontin promoter polymorphisms are associated with susceptibility to gastric cancer.
23416968 2013 Osteopontin splice variants expressed by breast tumors regulate monocyte activation via MCP-1 and TGF-?1.
23407481 2013 Serum osteopontin and tissue inhibitor of metalloproteinase 1 as diagnostic and prognostic biomarkers for pancreatic adenocarcinoma.
23388534 2013 [The role of osteopontin and adiponectin in the development of insulin resistance and hypertension in obesed adolescents].
23382482 2013 N-terminal rather than full-length osteopontin or its C-terminal fragment is associated with carotid-plaque inflammation in hypertensive patients.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23373240 2012 [Correlation study between OPN, CD44v6, MMP-9 and distant metastasis in laryngeal squamous cell carcinoma].
23361573 2013 Osteopontin: participation in inflammation or mucosal protection in inflammatory bowel diseases?
23354516 2013 Microarray analysis of gene expression in vestibular schwannomas reveals SPP1/MET signaling pathway and androgen receptor deregulation.
23352191 2013 Placental expression of osteopontin(OPN) in monochorionic twins with discordant growth.
23343383 2013 Plasma levels of osteopontin identify patients at risk for organ damage in systemic lupus erythematosus.
23289928 2013 OPN gene polymorphisms influence the risk of knee OA and OPN levels in synovial fluid in a Chinese population.
23284864 2012 Fetuin, matrix-Gla protein and osteopontin in calcification of renal allografts.
23274598 2013 Alterations in osteopontin modify muscle size in females in both humans and mice.
23269624 2013 Regulatory role of osteopontin in malignant transformation of endometrial cancer.
23263636 2013 Hypoxia-related molecules HIF-1?, CA9, and osteopontin : predictors of survival in patients with high-grade glioma.
23251004 2013 Reciprocal interactions between tumor-associated macrophages and CD44-positive cancer cells via osteopontin/CD44 promote tumorigenicity in colorectal cancer.
23244138 2012 Expression and clinical significance of osteopontin in calcified breast tissue.
23235966 2012 SPP1 gene polymorphisms associated with nephrolithiasis in Turkish pediatric patients.
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
23232694 2013 Abnormal XPD-induced nuclear receptor transactivation in DNA repair disorders: trichothiodystrophy and xeroderma pigmentosum.
23204518 2013 Thrombin-cleaved fragments of osteopontin are overexpressed in malignant glial tumors and provide a molecular niche with survival advantage.
23203407 2013 Postoperative serum osteopontin level is a novel monitor for treatment response and tumor recurrence after resection of hepatitis B-related hepatocellular carcinoma.
23166604 2012 Osteopontin level in synovial fluid is associated with the severity of joint pain and cartilage degradation after anterior cruciate ligament rupture.
23165334 2013 The correlations of LMX1A and osteopontin expression to the clinicopathologic stages in pancreatic adenocarcinoma.
23132541 2013 Phosphorylation of osteopontin in osteoarthritis degenerative cartilage and its effect on matrix metalloprotease 13.
23122494 2013 Serum level of osteopontin as a prognostic factor in patients who underwent surgical resection for non-small-cell lung cancer.
23119061 2012 Overexpression of osteopontin, ?v?3 and Pim-1 associated with prognostically important clinicopathologic variables in non-small cell lung cancer.
23117696 2013 The value of osteopontin in the assessment of bone mineral density status in postmenopausal women.
23112867 2012 Osteopontin-enhanced hepatic metastasis of colorectal cancer cells.
23098767 2013 Increased levels of osteopontin in sputum supernatant of smoking asthmatics.
23097037 2013 Soluble levels of osteopontin in patients with Behcet's disease: association with disease activity and vascular involvement.
23089492 2013 Preferential up-regulation of osteopontin in primary central nervous system lymphoma does not correlate with putative receptor CD44v6 or CD44H expression.
23079960 2013 Osteopontin promoter polymorphisms at locus -443 significantly affect the metastasis and prognosis of human hepatocellular carcinoma.
23074199 2012 Osteopontin increases heme oxygenase-1 expression and subsequently induces cell migration and invasion in glioma cells.
23072570 2012 Genetic polymorphisms in the osteopontin promoter increases the risk of distance metastasis and death in Chinese patients with gastric cancer.
23071279 2012 CCR2(+)CCR5(+) T cells produce matrix metalloproteinase-9 and osteopontin in the pathogenesis of multiple sclerosis.
23064961 2013 GWAS of dental caries patterns in the permanent dentition.
23055574 2012 Osteopontin and other regulators of angiogenesis and fibrogenesis in the vitreous from patients with proliferative vitreoretinal disorders.
23033660 2012 [Changes of left ventricular myocardial collagen fibers and osteopontin expression in hypertrophic cardiomyopathy].
23008732 2012 The impact of osteopontin gene variations on multiple sclerosis development and progression.
22978720 2012 In vitro and clinical studies examining the expression of osteopontin in cigarette smoke-exposed endothelial cells and cigarette smokers.
22964303 2012 Gravity-sensitive signaling drives 3-dimensional formation of multicellular thyroid cancer spheroids.
22960022 2012 Association of smooth muscle cell phenotypes with extracellular matrix disorders in thoracic aortic dissection.
22935225 Elevated serum osteopontin levels in idiopathic retroperitoneal fibrosis.
22927944 2012 Breast cancer metastasis suppressor 1 regulates hepatocellular carcinoma cell apoptosis via suppressing osteopontin expression.
22918393 2012 Prognostic utility of pre-operative circulating osteopontin, carbonic anhydrase IX and CRP in renal cell carcinoma.
22895562 2012 Role of the angiogenic components, VEGFA, FGF2, OPN and RHOC, in urothelial cell carcinoma of the urinary bladder.
22882568 2012 The association of osteopontin and LMX1A expression with World Health Organization grade in meningiomas and gliomas.
22855173 2013 EGFR expression is linked to osteopontin and Nf-?B signaling in clear cell renal cell carcinoma.
22847114 2012 Osteopontin increases the expression of ?1, 4-galactosyltransferase-I and promotes adhesion in human RL95-2 cells.
22844418 2012 CTX (crosslaps) rather than osteopontin is associated with disturbed glucose metabolism in gestational diabetes.
22835614 2013 Effectiveness of mesothelin family proteins and osteopontin for malignant mesothelioma.
22818182 2012 Osteopontin regulates interleukin-17 production in hepatitis.
22807608 2012 Osteopontin increases hepatocellular carcinoma cell growth in a CD44 dependant manner.
22784028 2012 IFN-? inhibits osteopontin expression in human decidual stromal cells and can be attenuated by 1?,25-dihydroxyvitamin D3.
22779921 2012 A yeast two-hybrid screen reveals that osteopontin associates with MAP1A and MAP1B in addition to other proteins linked to microtubule stability, apoptosis and protein degradation in the human brain.
22744661 2012 Importance of SPP1 genotype as a covariate in clinical trials in Duchenne muscular dystrophy.
22730056 2012 Elevated serum osteopontin levels in chronic hepatitis C virus infection: association with autoimmune rheumatologic manifestations.
22711477 2012 Osteopontin promotes inflammation in patients with acute coronary syndrome through its activity on IL-17 producing cells.
22710694 2012 Urinary NGAL, cystatin C, ?2-microglobulin, and osteopontin significance in hydronephrotic children.
22699784 2011 OPN gene polymorphisms are associated with susceptibility and clinicopatholigical characteristics of cervical cancer in a Chinese cohort.
22684781 2012 Modification of osteopontin and MMP-9 levels in patients with psoriasis on anti-TNF-? therapy.
22675553 2012 Hepatocyte growth factor increases osteopontin expression in human osteoblasts through PI3K, Akt, c-Src, and AP-1 signaling pathway.
22658130 2012 Evaluation of osteopontin and CD44v6 expression in odontogenic cystic lesions by immunohistochemistry.
22640692 2013 Serum osteoprotegerin and osteopontin levels are associated with arterial stiffness and the presence and severity of coronary artery disease.
22629140 2012 Prognostic value of hepatocyte growth factor, syndecan-1, and osteopontin in multiple myeloma and monoclonal gammopathy of undetermined significance.
22611763 2012 Osteopontin expression in chronic plaque psoriasis: an association with the severity of disease.
22591637 2012 FLJ10540 is associated with tumor progression in nasopharyngeal carcinomas and contributes to nasopharyngeal cell proliferation, and metastasis via osteopontin/CD44 pathway.
22584029 2012 Association of an Osteopontin gene promoter polymorphism with susceptibility to diabetic nephropathy in Asian Indians.
22582013 2012 Secreted kinase phosphorylates extracellular proteins that regulate biomineralization.
22580396 2012 Significant peri-operative reduction in plasma osteopontin levels after coronary artery by-pass grafting.
22558919 2012 Miscarriage, and TNF-? and osteopontin relationship in women patients with Hashimoto's thyroiditis.
22530059 2012 The osteopontin level in liver, adipose tissue and serum is correlated with fibrosis in patients with alcoholic liver disease.
22525502 2011 [Identification of metastasis-related osteopontin expression and glycosylation in hepatocellular carcinoma].
22516995 2012 [Expression of osteopontin in labial glands of patients with primary Sjögren's syndrome].
22510874 2012 Osteopontin is a prognostic factor for survival of acute myeloid leukemia patients.
22499302 Immunohistochemical study of osteopontin, Ki-67, and CD34 of psoriasis in Mansoura, Egypt.
22495819 2012 Both osteopontin-c and osteopontin-b splicing isoforms exert pro-tumorigenic roles in prostate cancer cells.
22492090 2012 Reactive oxygen species regulate osteopontin expression in a murine model of postischemic neovascularization.
22490528 2012 NKT cells and the hedgehog pathway: an unhealthy marriage in non-alcoholic fatty liver disease?
22461132 2012 Osteopontin expression is associated with improved survival in patients with pancreatic adenocarcinoma.
22458913 2012 Osteopontin and symmetric dimethylarginine plasma levels in solitary functioning kidney in children.
22456539 2012 Gottron's papules exhibit dermal accumulation of CD44 variant 7 (CD44v7) and its binding partner osteopontin: a unique molecular signature.
22431140 2012 TGFBR2 but not SPP1 genotype modulates osteopontin expression in Duchenne muscular dystrophy muscle.
22421411 2012 Interleukin-6, osteopontin and Raf/MEK/ERK signaling modulate the sensitivity of human myeloma cells to alkylphosphocholines.
22410369 2012 Expressions of matrix metalloproteinase-9 (MMP-9), dentin sialophosphoprotein (DSPP), and osteopontin (OPN) at histologically negative surgical margins may predict recurrence of oral squamous cell carcinoma.
22402440 2012 Osteopontin in systemic sclerosis and its role in dermal fibrosis.
22329905 2012 Increased levels of IL-23 and osteopontin in serum and cerebrospinal fluid of multiple sclerosis patients.
22261033 2012 Cigarette smoke induction of osteopontin (SPP1) mediates T(H)17 inflammation in human and experimental emphysema.
22242114 2011 The role of osteopontin (OPN/SPP1) haplotypes in the susceptibility to Crohn's disease.
22219064 2012 Combination of haptoglobin and osteopontin could predict colorectal cancer hepatic metastasis.
22218639 2013 The effect of hyaluronic acid on osteopontin and CD44 mRNA of fibroblast-like synoviocytes in patients with osteoarthritis of the knee.
22207105 2012 Osteopontin and integrin are involved in cholesterol gallstone formation.
22186244 The elevated expression of osteopontin and vascular endothelial growth factor in sinonasal inverted papilloma and its relationship with clinical severity.
22179617 2012 C-terminal modification of osteopontin inhibits interaction with the ?V?3-integrin.
22175901 2011 Osteopontin is highly expressed in severely dystrophic muscle and seems to play a role in muscle regeneration and fibrosis.
22158061 2012 Cyclic tensile strain facilitates the ossification of ligamentum flavum through ?-catenin signaling pathway: in vitro analysis.
22131818 2011 Osteopontin alleles are associated with clinical characteristics in systemic lupus erythematosus.
22115341 2012 Serum levels of calcification inhibitors in patients with intracerebral hemorrhage.
22096023 2012 Prognostic significance of plasma osteopontin in patients with locoregionally advanced head and neck squamous cell carcinoma treated on TROG 02.02 phase III trial.
22093695 2012 Analysis of osteopontin levels for the identification of asymptomatic patients with calcific aortic valve disease.
22080623 2012 Renal scarring and osteopontin gene C/T polymorphism in children with primary vesicoureteral reflux.
22039306 2011 ?9?1 integrin-mediated signaling serves as an intrinsic regulator of pathogenic Th17 cell generation.
22038347 2011 The elevated expression of osteopontin and NF-?B in human aortic aneurysms and its implication.
22037626 2012 Osteopontin, a protein with cytokine-like properties: a possible involvement in pemphigus vulgaris.
22037483 2012 Up-regulation of osteopontin expression by aryl hydrocarbon receptor via both ligand-dependent and ligand-independent pathways in lung cancer.
22031818 2011 Secreted osteopontin is highly polymerized in human airways and fragmented in asthmatic airway secretions.
21992455 2011 Prognosis of ampullary cancer based on immunohistochemical type and expression of osteopontin.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21986140 2011 Osteopontin levels are elevated in patients with asthma.
21983451 2011 Urinary OPN excretion in children with glomerular proteinuria.
21968021 2011 Osteopontin and endostatin concentrations in peripheral blood of patients with adrenal tumors undergoing unilateral adrenalectomy.
21963599 2012 Expression analysis of osteopontin mRNA splice variants in prostate cancer and benign prostatic hyperplasia.
21962803 2012 The role of osteopontin and osteopontin aptamer (OPN-R3) in fibroblast activity.
21953299 2012 Identification of osteopontin as a novel marker for early hepatocellular carcinoma.
21935388 2011 Correlation of circulating omentin-1 with bone mineral density in multiple sclerosis: the crosstalk between bone and adipose tissue.
21909361 2011 Osteopontin enhances the expression and activity of MMP-2 via the SDF-1/CXCR4 axis in hepatocellular carcinoma cell lines.
21900386 2011 The expression and pathophysiological role of osteopontin in Graves' disease.
21867616 2011 [Expression of osteopontin and VEGF in acute leukemia and their relationship with angiogenesis].
21853313 2011 Overexpression of osteopontin and integrin ?v in laryngeal and hypopharyngeal carcinomas associated with differentiation and metastasis.
21842122 Effects of osteopontin downregulation on the growth of prostate cancer PC-3 cells.
21838826 2012 Osteopontin expression in plasma of melanoma patients and in melanocytic tumours.
21822558 2012 Recurrence and poor prognosis following resection of small hepatitis B-related hepatocellular carcinoma lesions are associated with aberrant tumor expression profiles of glypican 3 and osteopontin.
21810982 2011 Elevated serum osteopontin levels and genetic polymorphisms of osteopontin are associated with Vogt-Koyanagi-Harada disease.
21796134 2011 Association between osteopontin promoter variants and diastolic dysfunction in hypertensive heart in the Japanese population.
21785824 Osteopontin regulates growth and migration of human nasopharyngeal cancer cells.
21772333 2011 Wnt-?-catenin-Tcf-4 signalling-modulated invasiveness is dependent on osteopontin expression in breast cancer.
21768699 Osteopontin expression in nasopharyngeal carcinoma: its relevance to the clinical stage of the disease.
21763380 2011 Association of osteopontin regulatory polymorphisms with systemic sclerosis.
21743018 2011 Expression profile of the matricellular protein osteopontin in primary open-angle glaucoma and the normal human eye.
21706367 2012 Elevated content of osteopontin in plasma and tumor tissues of patients with laryngeal and hypopharyngeal carcinoma associated with metastasis and prognosis.
21703197 2011 c-Met activation through a novel pathway involving osteopontin mediates oncogenesis by the transcription factor LSF.
21673011 2011 Osteopontin stimulates preneoplastic cellular proliferation through activation of the MAPK pathway.
21669963 2011 Abnormal expression of the ERG transcription factor in prostate cancer cells activates osteopontin.
21645921 2011 Involvement of osteopontin and its signaling molecule CD44 in clinicopathological features of adult T cell leukemia.
21632990 2011 Correlation between osteopontin messenger RNA expression and microcalcification shown on sonography in papillary thyroid carcinoma.
21630219 2011 Expression and regulation of nicotine receptor and osteopontin isoforms in human pancreatic ductal adenocarcinoma.
21616556 2011 Overexpression of osteopontin induces angiogenesis of endothelial progenitor cells via the av?3/PI3K/AKT/eNOS/NO signaling pathway in glioma cells.
21609000 2011 The metastasis-associated extracellular matrix protein osteopontin forms transient structure in ligand interaction sites.
21585607 2011 Increased gastric osteopontin expression by Helicobacter pylori Infection can correlate with more severe gastric inflammation and intestinal metaplasia.
21556958 2011 Osteopontin enhances HIV replication and is increased in the brain and cerebrospinal fluid of HIV-infected individuals.
21547579 2011 VHL genetic alteration in CCRCC does not determine de-regulation of HIF, CAIX, hnRNP A2/B1 and osteopontin.
21539822 2011 Increased levels of bone remodeling biomarkers (osteoprotegerin and osteopontin) in hypertensive individuals.
21521652 2011 Increased serum osteopontin levels in autistic children: relation to the disease severity.
21520066 2011 Osteopontin controls endothelial cell migration in vitro and in excised human valvular tissue from patients with calcific aortic stenosis and controls.
21513757 2011 Behçet's disease exhibits an increased osteopontin serum level in active stage but no association with osteopontin and its receptor gene polymorphisms.
21512310 2011 Osteopontin as a key mediator for vasculogenic mimicry in hepatocellular carcinoma.
21508397 2011 Impact of renal failure on the tumor markers of mesothelioma, N-ERC/mesothelin and osteopontin.
21501293 2011 Osteopontin, intrinsic tissue regulator of intractable inflammatory diseases.
21487672 2011 Synergistic effect of recombinant human bone morphogenic protein-7 and osteogenic differentiation medium on human bone-marrow-derived mesenchymal stem cells in vitro.
21487066 2011 Plasma markers for identifying patients with metastatic melanoma.
21486700 2011 Systemic blood osteopontin, endostatin, and E-selectin concentrations after vertical banding surgery in severely obese adults.
21469198 2011 Osteopontin polymorphic susceptibility factor for Parkinson's disease among patients with Gaucher disease.
21467192 2011 Osteopontin is an activator of human adipose tissue macrophages and directly affects adipocyte function.
21443102 Identification of potential biomarkers for early and advanced gastric adenocarcinoma detection.
21440761 2011 Circulating levels of osteopontin are related with calcification parameters in patients with renal transplantations.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21397972 2011 Plasma versus serum levels of osteopontin and mesothelin in patients with malignant mesothelioma--which is best?
21375772 2011 MicroRNA array and microarray evaluation of endometrial receptivity in patients with high serum progesterone levels on the day of hCG administration.
21374592 2012 Osteopontin stimulates autophagy via integrin/CD44 and p38 MAPK signaling pathways in vascular smooth muscle cells.
21366712 2012 Plasma and tissue osteopontin in relation to plasma selenium in patients with psoriasis.
21365018 2011 Expression of high-mobility groups box-1/receptor for advanced glycation end products/osteopontin/early growth response-1 pathway in proliferative vitreoretinal epiretinal membranes.
21343932 2011 Expression of osteopontin coregulators in primary colorectal cancer and associated liver metastases.
21321126 2011 Osteopontin undergoes polymerization in vivo and gains chemotactic activity for neutrophils mediated by integrin alpha9beta1.
21315424 2011 Osteopontin expression in ovarian carcinoma effusions is related to improved clinical outcome.
21290088 2011 Suppressing tumourigenicity of prostate cancer cells by inhibiting osteopontin expression.
21273622 2011 The dynamics of serum tumor markers in predicting metastatic uveal melanoma (part 1).
21273567 2011 Osteopontin reduced hypoxia-ischemia neonatal brain injury by suppression of apoptosis in a rat pup model.
21272459 2011 [Relative analysis of OPN and its related signal molecules in hepatocellular carcinoma].
21263033 2011 Osteopontin-c splicing isoform contributes to ovarian cancer progression.
21252118 2011 Osteopontin promotes CCL5-mesenchymal stromal cell-mediated breast cancer metastasis.
21247495 2011 Deletion of the thrombin cleavage domain of osteopontin mediates breast cancer cell adhesion, proteolytic activity, tumorgenicity, and metastasis.
21217752 2011 Genetic deficiency of tartrate-resistant acid phosphatase associated with skeletal dysplasia, cerebral calcifications and autoimmunity.
21207061 2011 Osteopontin as a potential biomarker of proliferation and invasiveness for lung cancer.
21190594 2010 Transcription factor c-Myb promotes the invasion of hepatocellular carcinoma cells via increasing osteopontin expression.
21188534 2011 Overexpression of osteopontin in hepatocellular carcinoma and its relationships with metastasis, invasion of tumor cells.
21178099 2011 SPP1 genotype is a determinant of disease severity in Duchenne muscular dystrophy.
21174062 2011 Down-regulation of osteopontin inhibits metastasis of hepatocellular carcinoma cells via a mechanism involving MMP-2 and uPA.
21167650 2011 Osteopontin expression correlates with nuclear factor-?B activation and apoptosis downregulation in clear cell renal cell carcinoma.
21167394 2010 Clinical significance of plasma osteopontin level in Egyptian patients with hepatitis C virus-related hepatocellular carcinoma.
21165579 2011 Categorical meta-analysis of Osteopontin as a clinical cancer marker.
21152079 2010 Prognostic biomarkers for esophageal adenocarcinoma identified by analysis of tumor transcriptome.
21104439 2011 Osteopontin promotes hepatocellular carcinoma invasion by up-regulating MMP-2 and uPA expression.
21071960 2011 Prognostic implication of plasma osteopontin levels in patients with chronic kidney disease.
21067798 2011 Prothrombin haplotype associated with kidney stone disease in Northeastern Thai patients.
21044748 2010 Association between the T-593A and C6982T polymorphisms of the osteopontin gene and risk of developing nephrolithiasis.
21034455 2010 Plasma concentrations of osteopontin, but not thrombin-cleaved osteopontin, are associated with the presence and severity of nephropathy and coronary artery disease in patients with type 2 diabetes mellitus.
21028999 2010 The relationship between osteopontin and adiponectin in patients with essential hypertension.
20978319 2010 VHL genetic alteration in CCRCC does not determine de-regulation of HIF, CAIX, hnRNP A2/B1 and osteopontin.
20967551 2011 Osteopontin predicts long-term functional outcome among ischemic stroke patients.
20967421 2011 Quantitative genetic study of the circulating osteopontin in community-selected families.
20961744 2011 Up-regulation of the novel proinflammatory adipokines lipocalin-2, chitinase-3 like-1 and osteopontin as well as angiogenic-related factors in visceral adipose tissue of patients with colon cancer.
20935448 Association of osteopontin and tumor necrosis factor-? levels with insulin resistance in obese patients with obstructive sleep apnea syndrome.
20921238 2011 Osteopontin concentrations are increased in cerebrospinal fluid during attacks of multiple sclerosis.
20890897 2010 Thrombin is a therapeutic target for metastatic osteopontin-positive hepatocellular carcinoma.
20874252 2010 Regulatory effects of interferon-? on osteopontin and interleukin-17 expression in multiple sclerosis.
20868520 2010 Regulation of Erk1/2 activation by osteopontin in PC3 human prostate cancer cells.
20863582 2011 Plasma osteopontin reveals left ventricular reverse remodelling following cardiac resynchronization therapy in heart failure.
20851233 2010 The effects of mifepristone on the expressions of osteopontin, interleukin-6 and leukemia inhibitory factor in the villi of early pregnant women.
20849637 2010 Effects of osteopontin inhibition on radiosensitivity of MDA-MB-231 breast cancer cells.
20823889 2010 Osteopontin is a marker for cancer aggressiveness and patient survival.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20796249 2010 Osteopontin levels are elevated in patients with eosinophilic pneumonia.
20689445 2010 Functional heterogeneity of osteopontin isoforms in non-small cell lung cancer.
20659235 2010 Osteopontin, a single marker for predicting the prognosis of patients with tumor-node-metastasis stage I hepatocellular carcinoma after surgical resection.
20638909 2010 Osteopontin and alphavbeta3 integrin as markers of endometrial receptivity: the effect of different hormone therapies.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20625700 2011 Lower osteocalcin and osteopontin contents of the femoral head in hip fracture patients than osteoarthritis patients.
20598232 2010 Nectin-like molecule 1 inhibits the migration and invasion of U251 glioma cells by regulating the expression of an extracellular matrix protein osteopontin.
20597997 2010 Role of the metastasis-promoting protein osteopontin in the tumour microenvironment.
20592361 2010 Osteopontin (OPN) expression in thyroid carcinoma.
20576283 2010 Micro-RNA-181a regulates osteopontin-dependent metastatic function in hepatocellular cancer cell lines.
20562127 2011 Osteopontin expression and relation to disease severity in human asthma.
20553297 2010 The expression of osteopontin and its association with Clara cell 10 kDa protein in allergic rhinitis.
20549562 2010 Osteopontin expression is an independent adverse prognostic factor in resectable gastrointestinal stromal tumor and its interaction with CD44 promotes tumor proliferation.
20545695 2010 Osteopontin is a new target molecule for ovarian clear cell carcinoma therapy.
20533542 2010 Role of osteopontin in synovial Th17 differentiation in rheumatoid arthritis.
20511184 2010 Expression pattern of osteopontin splice variants and its functions on cell apoptosis and invasion in glioma cells.
20505679 2010 SPP1 promoter polymorphisms and glioma risk in a Chinese Han population.
20501415 2010 [Expression of osteopontin and survivin in prostate cancer and the clinical significance].
20495387 2010 Osteopontin but not osteonectin favors the metastatic growth of pancreatic cancer cell lines.
20486203 2010 Plasma osteopontin as a predictor of coronary artery disease: association with echocardiographic characteristics of atherosclerosis.
20459645 2010 Osteopontin selectively regulates p70S6K/mTOR phosphorylation leading to NF-kappaB dependent AP-1-mediated ICAM-1 expression in breast cancer cells.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20428925 2010 Osteopontin expression is a valuable marker for prediction of short-term recurrence in WHO grade I benign meningiomas.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20384635 2010 Osteopontin can act as an effector for a germline mutation of BRCA1 in malignant transformation of breast cancer-related cells.
20378012 The osteopontin gene +1239A/C single nucleotide polymorphism is associated with type 1 diabetes mellitus in the Italian population.
20377868 2010 Elevated tumor and serum levels of the hypoxia-associated protein osteopontin are associated with prognosis for soft tissue sarcoma patients.
20349162 2010 Elevated osteopontin expression and proliferative/apoptotic ratio in the colorectal adenoma-dysplasia-carcinoma sequence.
20224789 2010 The RGD domain of human osteopontin promotes tumor growth and metastasis through activation of survival pathways.
20219412 2010 The implication of osteopontin (OPN) expression and genetic polymorphisms of OPN promoter in oral carcinogenesis.
20207476 2010 A short-hairpin RNA targeting osteopontin downregulates MMP-2 and MMP-9 expressions in prostate cancer PC-3 cells.
20155457 2010 Influence of osteopontin short hairpin RNA on the proliferation and invasion of human renal cancer cells.
20150368 2010 Osteopontin regulates human glioma cell invasiveness and tumor growth in mice.
20146103 2010 Clinical implication and mitotic effect of CD44 cleavage in relation to osteopontin/CD44 interaction and dysregulated cell cycle protein in gastrointestinal stromal tumor.
20144595 2010 The impact of osteopontin promoter polymorphisms on the risk of calcium urolithiasis.
20138033 2010 Plasma osteopontin concentration correlates with the severity of hepatic fibrosis and inflammation in HCV-infected subjects.
20131968 2010 Soluble mesothelin related peptides (SMRP) and osteopontin as protein biomarkers for malignant mesothelioma: analytical validation of ELISA based assays and characterization at mRNA and protein levels.
20109337 2010 Regulation of hypoxia-induced mRNA expressions of HIF-1alpha and osteopontin and in vitro radiosensitization by tirapazamine in human nasopharyngeal carcinoma HNE-1 and CNE-1 cells.
20101228 2010 Osteopontin-mediated enhanced hyaluronan binding induces multidrug resistance in mesothelioma cells.
20086024 2010 Increased osteopontin plasma levels in multiple sclerosis patients correlate with bone-specific markers.
20085934 2010 Reduction of elevated plasma osteopontin levels with resection of non-small-cell lung cancer.
20075512 2009 Genetic variation in osteopontin gene is associated with susceptibility to sarcoidosis in Slovenian population.
20074733 2010 Associations between plasma osteopontin levels and the severities of coronary and aortic atherosclerosis.
20071328 2010 Osteopontin is cleaved at multiple sites close to its integrin-binding motifs in milk and is a novel substrate for plasmin and cathepsin D.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
20038306 2010 [Expressions of osteopontin and B7-H4 in epithelial ovarian neoplasm and their significance].
20037822 2009 Implication of expression of osteopontin and its receptor integrin alphanubeta3 in the placenta in the development of preeclampsia.
20022267 Osteopontin overexpression predicts poor prognosis of upper urinary tract urothelial carcinoma.
20019453 2009 The relationship between coronary calcification and the metabolic markers of osteopontin, fetuin-A, and visfatin.
20019131 2010 Primary breast carcinoma: association of mammographic calcifications with osteopontin expression.
20008129 2010 Antigen-specific induction of osteopontin contributes to the chronification of allergic contact dermatitis.
20007708 2010 Adipocyte-mononuclear cell interaction, Toll-like receptor 4 activation, and high glucose synergistically up-regulate osteopontin expression via an interleukin 6-mediated mechanism.
20004120 2010 Beneficial changes of serum calcification markers and contralateral carotid plaques echogenicity after combined carotid artery stenting plus intensive lipid-lowering therapy in patients with bilateral carotid stenosis.
19952401 2009 [Expression of FGF-2 and osteopontin in non-small cell lung cancer].
19948844 2010 Vitamin D receptor activators induce an anticalcific paracrine program in macrophages: requirement of osteopontin.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19901966 2010 Interferon-induced transmembrane 3 binds osteopontin in vitro: expressed in vivo IFITM3 reduced OPN expression.
19887478 2009 Gene expression profiling of paraffin-embedded primary melanoma using the DASL assay identifies increased osteopontin expression as predictive of reduced relapse-free survival.
19885563 2009 Osteopontin splice variants differentially modulate the migratory activity of hepatocellular carcinoma cell lines.
19854170 2010 Osteoclast migration on phosphorylated osteopontin is regulated by endogenous tartrate-resistant acid phosphatase.
19850036 2010 Osteopontin induces beta-catenin signaling through activation of Akt in prostate cancer cells.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19813107 2010 Loss of p16INK4, alone and with overexpression of osteopontin, correlates with survival of patients with spinal metastasis from hepatocellular carcinoma.
19806573 2009 [Effect of osteopontin silencing by lentivirus-mediated delivery of siRNA on glioma cell invasion and apoptosis].
19805619 2009 Expression profiling of a hemopoietic cell survival transcriptome implicates osteopontin as a functional prognostic factor in AML.
19804447 2010 Osteopontin is expressed and functional in human eosinophils.
19798549 2010 Activation of RhoA and FAK induces ERK-mediated osteopontin expression in mechanical force-subjected periodontal ligament fibroblasts.
19790060 2009 Thrombin-activatable carboxypeptidase B cleavage of osteopontin regulates neutrophil survival and synoviocyte binding in rheumatoid arthritis.
19784742 2009 The immunohistochemical expression profile of osteopontin in normal human tissues using two site-specific antibodies reveals a wide distribution of positive cells and extensive expression in the central and peripheral nervous systems.
19783881 2009 Prognostic value of serum osteopontin in hepatocellular carcinoma patients treated with transarterial chemoembolization.
19781269 2009 [The expression of galectin-3 and osteopontin in occult metastasis of non-small cell lung cancer].
19780053 2010 Gene expression analysis identifies over-expression of CXCL1, SPARC, SPP1, and SULF1 in gastric cancer.
19767100 2010 Transactivation of human osteopontin promoter by human T-cell leukemia virus type 1-encoded Tax protein.
19763701 2010 Clinical significance of the upregulated osteopontin mRNA expression in human colorectal cancer.
19740309 2009 Hypoxia skews dendritic cells to a T helper type 2-stimulating phenotype and promotes tumour cell migration by dendritic cell-derived osteopontin.
19720619 2010 Adenosine and osteopontin contribute to the development of chronic obstructive pulmonary disease.
19706414 2009 Intracellular cleavage of osteopontin by caspase-8 modulates hypoxia/reoxygenation cell death through p53.
19694703 2009 Osteopontin expression correlates with invasiveness in cervical cancer.
19638732 2009 Persistent elevation of plasma osteopontin levels in HIV patients despite highly active antiretroviral therapy.
19634115 Osteopontin is not a specific marker in malignant pleural mesothelioma.
19609945 2010 Selective osteopontin knockdown exerts anti-tumoral activity in a human glioblastoma model.
19609729 2010 Comparison of osteopontin, beta-catenin and hnRNP B1 expression in lung carcinomas.
19603104 Osteopontin is associated with increased arterial stiffness in rheumatoid arthritis.
19602039 2009 Osteopontin promotes gastric cancer metastasis by augmenting cell survival and invasion through Akt-mediated HIF-1alpha up-regulation and MMP9 activation.
19601999 2009 A genetic polymorphism in transforming growth factor beta receptor-2 is associated with serum osteopontin.
19597469 2009 Osteopontin induces angiogenesis through activation of PI3K/AKT and ERK1/2 in endothelial cells.
19593583 2010 The prognostic significance of preoperative plasma levels of osteopontin in patients with TNM stage-I of hepatocellular carcinoma.
19581305 2009 Modulation of calcium oxalate dihydrate growth by selective crystal-face binding of phosphorylated osteopontin and polyaspartate peptide showing occlusion by sectoral (compositional) zoning.
19573311 2009 [Expression of integrin beta3 and osteopontin in endometrium of patients with adenomyosis].
19565503 2009 Role of osteopontin in induction of monocyte chemoattractant protein 1 and macrophage inflammatory protein 1beta through the NF-kappaB and MAPK pathways in rheumatoid arthritis.
19562270 2009 Overexpression of human osteopontin increases cell proliferation and migration in human embryo kidney-293 cells.
19556240 2009 The hedgehog pathway transcription factor GLI1 promotes malignant behavior of cancer cells by up-regulating osteopontin.
19549529 2009 Cyclooxygenase-2 inhibitors down-regulate osteopontin and Nr4A2-new therapeutic targets for colorectal cancers.
19538464 2010 Spheroid-forming subpopulation of breast cancer cells demonstrates vasculogenic mimicry via hsa-miR-299-5p regulated de novo expression of osteopontin.
19528482 2009 Osteopontin modulates malignant pleural mesothelioma cell functions in vitro.
19476604 2009 Osteopontin is upregulated in malignant and inflammatory pleural effusions.
19475568 2009 Osteopontin increases migration and MMP-9 up-regulation via alphavbeta3 integrin, FAK, ERK, and NF-kappaB-dependent pathway in human chondrosarcoma cells.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19400906 2009 Osteopontin is involved in migration of eosinophils in asthma.
19399415 2009 Expression of phosphorylated-STAT3 and osteopontin and their correlation in melanoma.
19376608 2010 Predictive significance of bone sialoprotein and osteopontin for bone metastases in resected Chinese non-small-cell lung cancer patients: a large cohort retrospective study.
19369471 2009 The hypoxic synovial environment regulates expression of vascular endothelial growth factor and osteopontin in juvenile idiopathic arthritis.
19366056 Role of osteopontin in breast cancer patients.
19365701 2009 Association of plasma osteopontin levels with coronary calcification evaluated by tomographic coronary calcium scoring.
19359522 2009 Essential role of osteopontin in smoking-related interstitial lung diseases.
19346516 2009 Polymeric osteopontin employs integrin alpha9beta1 as a receptor and attracts neutrophils by presenting a de novo binding site.
19340392 2009 A single-nucleotide polymorphism of the osteopontin gene may contribute to a susceptibility to Lewy body disease.
19339987 2009 Age- and gender-specific modulation of serum osteopontin and interferon-alpha by osteopontin genotype in systemic lupus erythematosus.
19337795 2009 Osteopontin protects against cardiac ischemia-reperfusion injury through late preconditioning.
19301019 2009 Osteopontin: a new emerging role in psoriasis.
19287188 2009 Expression analyses of human cleft palate tissue suggest a role for osteopontin and immune related factors in palatal development.
19285954 2009 Tumorigenic properties of alternative osteopontin isoforms in mesothelioma.
19285424 2009 Nitric oxide treatment reduces neo-intimal formation and modulates osteopontin expression in an ex-vivo human model of intimal hyperplasia.
19285028 2009 A functional motif QLYxxYP is essential for osteopontin induced T lymphocyte activation and migration.
19281985 2009 Osteopontin gene variation and cardio/cerebrovascular disease phenotypes.
19260859 2009 Endometrial osteopontin mRNA expression and plasma osteopontin levels are increased in patients with endometriosis.
19246678 2009 Osteopontin: a fibrosis-related marker molecule in cardiac remodeling of enterovirus myocarditis in the susceptible host.
19217889 2009 Correlation of plasma and synovial fluid osteopontin with disease severity in knee osteoarthritis.
19212618 2009 Expression of osteopontin and CDX2: indications of phenotypes and prognosis in advanced gastric cancer.
19208558 2009 Thrombin-cleaved osteopontin in synovial fluid of subjects with rheumatoid arthritis.
19184356 2009 Downregulating osteopontin reduces angiotensin II-induced inflammatory activation in vascular smooth muscle cells.
19138884 2009 Association of alleles at polymorphic sites in the Osteopontin encoding gene in young type 1 diabetic patients.
19076536 2009 Expression of osteopontin in chronic rhinosinusitis with and without nasal polyps.
19048398 2009 Correlation between osteopontin protein expression and histological grade of astrocytomas.
19028408 2009 Elevated plasma osteopontin level is associated with occurrence of psoriasis and is an unfavorable cardiovascular risk factor in patients with psoriasis.
19023151 2009 Prognostic significance of plasma osteopontin levels in patients undergoing percutaneous coronary intervention.
19017937 2008 Increased osteopontin expression in dendritic cells amplifies IL-17 production by CD4+ T cells in experimental autoimmune encephalomyelitis and in multiple sclerosis.
19016748 2008 Osteopontin promotes ovarian cancer progression and cell survival and increases HIF-1alpha expression through the PI3-K/Akt pathway.
19014781 2008 Correlation between tumor growth delay and expression of cancer and host VEGF, VEGFR2, and osteopontin in response to radiotherapy.
19010864 2008 Activation of the osteopontin/matrix metalloproteinase-9 pathway correlates with prostate cancer progression.
19010227 2008 Role of osteopontin and CD44s expression for patients with hepatocellular carcinoma undergoing liver transplantation or resection.
18997126 2008 Osteopontin combined with CD44, a novel prognostic biomarker for patients with hepatocellular carcinoma undergoing curative resection.
18996613 2009 Osteopontin increases lung cancer cells migration via activation of the alphavbeta3 integrin/FAK/Akt and NF-kappaB-dependent pathway.
18972404 2008 Lentiviral-mediated miRNA against osteopontin suppresses tumor growth and metastasis of human hepatocellular carcinoma.
18952835 2009 Elevated expression of osteopontin may be related to adipose tissue macrophage accumulation and liver steatosis in morbid obesity.
18949741 Osteopontin expression according to molecular profile of invasive breast cancer: a clinicopathological and immunohistochemical study.
18807011 2008 Serum levels of osteopontin are increased in SIRS and sepsis.
18787423 2009 Immuno-localization of CD44 and osteopontin in developing human kidney.
18722093 2008 Endothelin signaling axis activates osteopontin expression through PI3 kinase pathway in A375 melanoma cells.
18701136 2008 Overexpression of osteopontin independently correlates with vascular invasion and poor prognosis in patients with hepatocellular carcinoma.
18694758 2008 Molecular basis of recognition of human osteopontin by 23C3, a potential therapeutic antibody for treatment of rheumatoid arthritis.
18694621 2008 A small interfering RNA targeting osteopontin as gastric cancer therapeutics.
18682895 2009 Role of MAPK in mechanical force-induced up-regulation of type I collagen and osteopontin in human gingival fibroblasts.
18676742 2008 Gene expression profiling of papillary thyroid carcinoma identifies transcripts correlated with BRAF mutational status and lymph node metastasis.
18670302 2008 Comparison of osteopontin, megakaryocyte potentiating factor, and mesothelin proteins as markers in the serum of patients with malignant mesothelioma.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18651220 2009 Role of osteopontin in calcification in autoimmune pancreatitis.
18629582 2008 Osteopontin expression in squamous cell cancer of the esophagus.
18627421 2009 Osteopontin as two-sided mediator of intestinal inflammation.
18616394 2008 Osteopontin is increased in HIV-associated dementia.
18593988 2008 Osteopontin and interleukin-8 expression is independently associated with prostate cancer recurrence.
18563556 2009 Expression profiling of familial breast cancers demonstrates higher expression of FGFR2 in BRCA2-associated tumors.
18550471 2008 Prognostic role of osteopontin expression in malignant pleural mesothelioma.
18549897 2008 RNA stability regulates differential expression of the metastasis protein, osteopontin, in hepatocellular cancer.
18549690 2008 Osteopontin and alphavbeta3 integrin expression in the endometrium of infertile and fertile women.
18537194 2008 Thirty-kilodalton Tat-interacting protein suppresses tumor metastasis by inhibition of osteopontin transcription in human hepatocellular carcinoma.
18524812 2008 Expression of immunomodulatory genes, their protein products and specific ligands/receptors during the window of implantation in the human endometrium.
18508510 2008 Role of osteopontin in cellular signaling and metastatic phenotype.
18493866 2008 Osteopontin expression correlates with angiogenesis and survival in malignant astrocytoma.
18480255 2008 Alternative translation of osteopontin generates intracellular and secreted isoforms that mediate distinct biological activities in dendritic cells.
18474739 2008 Increased osteopontin levels in the cerebrospinal fluid of patients with multiple sclerosis.
18470911 2008 Downregulation of osteopontin contributes to metastasis suppression by breast cancer metastasis suppressor 1.
18459127 2009 The functional -443T/C osteopontin promoter polymorphism influences osteopontin gene expression in melanoma cells via binding of c-Myb transcription factor.
18443355 2008 The role of osteopontin in the development of albuminuria.
18442196 2008 Identification of osteopontin as the most consistently over-expressed gene in intrahepatic cholangiocarcinoma: detection by oligonucleotide microarray and real-time PCR analysis.
18413297 2008 Thrombin hydrolysis of human osteopontin is dependent on thrombin anion-binding exosites.
18410276 2008 Neuromyelitis optica/Devic's disease: gene expression profiling of brain lesions.
18406574 2008 Osteopontin promoter polymorphism is associated with increased carotid intima-media thickness.
18396783 Osteopontin expression in human decidua is associated with decidual natural killer cells recruitment and regulated by progesterone.
18393978 2008 Overexpression of osteopontin in clear cell carcinoma of the ovary: close association with HNF-1beta expression.
18388057 Elevated osteopontin levels in patients with peripheral arterial disease.
18353318 2009 Infertile women with isolated polycystic ovaries are deficient in endometrial expression of osteopontin but not alphavbeta3 integrin during the implantation window.
18335026 2008 Osteopontin and systemic lupus erythematosus association: a probable gene-gender interaction.
18317949 2008 Haplotype analysis revealed a genetic influence of osteopontin on large artery atherosclerosis.
18210878 2007 [Over-expression of osteopontin in non-small cell lung cancers: its clinical significance].
18210151 2008 Clinical significance of osteopontin expression in cervical cancer.
18197854 2008 Osteopontin expression in oral lichen planus.
18181047 2008 Positive correlation of osteopontin, cyclooxygenase-2 and vascular endothelial growth factor in gastric cancer.
18178454 2008 The relationship between serum levels of vascular calcification inhibitors and carotid plaque vulnerability.
18174176 2008 Osteopontin regulates actin cytoskeleton and contributes to cell proliferation in primary erythroblasts.
18167187 2007 Osteopontin gene polymorphism in association with systemic lupus erythematosus in Chinese patients.
18162078 2008 Ethanol increases fetal human neurosphere size and alters adhesion molecule gene expression.
18160829 2007 [Clinical significance of serum osteopontin in patients with multiple myeloma].
18158320 2008 Syndecan-4 protects against osteopontin-mediated acute hepatic injury by masking functional domains of osteopontin.
18155656 2008 Hypoxic osteocytes recruit human MSCs through an OPN/CD44-mediated pathway.
18085382 2007 Large cell neuroendocrine carcinoma of the lung with calcification and expression of osteopontin.
18079410 2008 Osteopontin expression is required for myofibroblast differentiation.
18072945 2008 Post-translational modification and proteolytic processing of urinary osteopontin.
18053633 2008 Site localization of membrane-bound proteins on whole cell level using atomic force microscopy.
18048491 2008 Osteopontin expression in human and murine obesity: extensive local up-regulation in adipose tissue but minimal systemic alterations.
18037740 2007 Osteopontin expression of circulating T cells and plasma osteopontin levels are increased in relation to severity of heart failure.
18004082 2007 Protein expression of osteopontin in tumor tissues is an independent prognostic indicator in gastric cancer.
17987038 2007 OPN/CD44v6 overexpression in laryngeal dysplasia and correlation with clinical outcome.
17960616 2008 Osteopontin-c is a selective marker of breast cancer.
17938278 2008 Osteopontin expression in normal skin and non-melanoma skin tumors.
17898038 2007 Renal calcinosis and stone formation in mice lacking osteopontin, Tamm-Horsfall protein, or both.
17896150 2007 Prognostic significance of osteopontin expression in human gastric carcinoma.
17884775 2007 [Association of osteopontin gene polymorphism with lupus nephritis in Chinese Han population].
17852826 2007 Biological variation and reference intervals for circulating osteopontin, osteoprotegerin, total soluble receptor activator of nuclear factor kappa B ligand and high-sensitivity C-reactive protein.
17848618 2007 The new tumor-suppressor gene inhibitor of growth family member 4 (ING4) regulates the production of proangiogenic molecules by myeloma cells and suppresses hypoxia-inducible factor-1 alpha (HIF-1alpha) activity: involvement in myeloma-induced angiogenesis.
17721886 2007 Osteopontin overexpression in breast cancer: knowledge gained and possible implications for clinical management.
17706953 2007 Osteoprotegerin upregulates endothelial cell adhesion molecule response to tumor necrosis factor-alpha associated with induction of angiopoietin-2.
17696803 2007 Role of osteopontin in regulating hepatic inflammatory responses and toxic liver injury.
17689681 2007 Sp1 regulates osteopontin expression in SW480 human colon adenocarcinoma cells.
17620367 2007 Osteopontin gene expression determines spontaneous metastatic performance of orthotopic human breast cancer xenografts.
17595250 2007 Plasma osteopontin levels and expression in adipose tissue are increased in obesity.
17565744 2007 Expression of osteopontin, a target gene of de-regulated Wnt signaling, predicts survival in colon cancer.
17548669 2007 The role of osteopontin in tumor progression and metastasis in breast cancer.
17545592 2007 Human macrophages promote the motility and invasiveness of osteopontin-knockdown tumor cells.
17519954 2007 Association of osteopontin gene haplotypes with nephrolithiasis.
17496055 2007 SPP1 polymorphisms associated with HBV clearance and HCC occurrence.
17493236 2007 Osteopontin is linked to p65 and MMP-9 expression in pulmonary adenocarcinoma but not in malignant pleural mesothelioma.
17482311 2007 Abrogation of the interaction between osteopontin and alphavbeta3 integrin reduces tumor growth of human lung cancer cells in mice.
17482182 2007 Immunohistochemical study of osteopontin and L-selectin in a rat endometriosis model and in human endometriosis.
17464350 2007 Inhibition of osteopontin would suppress angiogenesis in gastric cancer.
17452979 2007 An osteopontin fragment is essential for tumor cell invasion in hepatocellular carcinoma.
17444956 2007 Osteopontin, a protein with cytokine-like properties, is associated with inflammation in Crohn's disease.
17441427 2007 [Expression of connective tissue growth factor (CTGF), osteopontin (OPN) and clinical significances in the laryngeal squamous cell carcinoma tissues].
17439891 2007 The 795CT polymorphism in osteopontin gene is not associated with multiple sclerosis in a Spanish population.
17418101 2007 Lack of sphingosine 1-phosphate-degrading enzymes in erythrocytes.
17384004 2007 SPP1 promoter polymorphisms: identification of the first modifier gene for pseudoxanthoma elasticum.
17369493 2007 Osteopontin prevents monocyte recirculation and apoptosis.
17360982 2007 PPARalpha agonists suppress osteopontin expression in macrophages and decrease plasma levels in patients with type 2 diabetes.
17343740 2007 Mechanisms of osteopontin and CD44 as metastatic principles in prostate cancer cells.
17332338 2007 Osteopontin promotes integrin activation through outside-in and inside-out mechanisms: OPN-CD44V interaction enhances survival in gastrointestinal cancer cells.
17316167 2007 Increased expression of the remodeling- and tumorigenic-associated factor osteopontin in pyramidal neurons of the Alzheimer's disease brain.
17289872 2007 Myeloma cell-osteoclast interaction enhances angiogenesis together with bone resorption: a role for vascular endothelial cell growth factor and osteopontin.
17253181 2007 [Expression of Ras-GTPase-activating protein SH 3 domain binding protein and osteopontin in esophageal squamous carcinoma and their effects on prognosis].
17245215 2007 High plasma osteopontin levels in patients with inflammatory bowel disease.
17244457 2007 [Osteopontin promotes the malignant phenotypes of human hepatocellular carcinoma cell line SMMC-7721].
17227585 2007 Breast cancer metastasis suppressor 1 (BRMS1) inhibits osteopontin transcription by abrogating NF-kappaB activation.
17189522 2007 Osteopontin upregulation and polymerization by transglutaminase 2 in calcified arteries of Matrix Gla protein-deficient mice.
17188882 2007 Osteopontin is elevated in Parkinson's disease and its absence leads to reduced neurodegeneration in the MPTP model.
17170369 2007 Association between osteopontin and human abdominal aortic aneurysm.
17130676 2006 Osteopontin: a potential biomarker for successful bee venom immunotherapy and a potential molecule for inhibiting IgE-mediated allergic responses.
17110905 2006 Smoking is associated with increased levels of osteopontin in type 2 diabetic patients: preliminary results.
17044113 2007 Osteopontin dysregulation and lytic bone lesions in multiple myeloma.
17022822 2006 Effects of THBS3, SPARC and SPP1 expression on biological behavior and survival in patients with osteosarcoma.
17005603 2007 Osteopontin localizes to the nucleus of 293 cells and associates with polo-like kinase-1.
16962083 2006 Osteopontin expression in substantia nigra in MPTP-treated primates and in Parkinson's disease.
16880782 2006 Expression of osteopontin in oesophageal squamous cell carcinoma.
16830223 2006 Osteopontin knockdown suppresses tumorigenicity of human metastatic breast carcinoma, MDA-MB-435.
16817793 2006 Osteopontin expression in vascular smooth muscle cells in patients with end-stage renal disease.
16807684 2006 Phosphoproteomic analysis of the human pituitary.
16807238 2006 Osteopontin induction of hyaluronan synthase 2 expression promotes breast cancer malignancy.
16797773 2006 Intrahepatic gene expression in human alcoholic hepatitis.
16786357 2006 The prognostic significance of preoperative plasma levels of osteopontin in patients with hepatocellular carcinoma.
16765311 2006 Osteopontin is involved in Th1-mediated immunity against Plasmodium falciparum infection in a holoendemic malaria region in Vietnam.
16741188 2006 Cytokine polymorphisms associated with carotid intima-media thickness in stroke patients.
16720713 2006 Cycling and early pregnant endometrium as a site of regulated expression of the vitamin D system.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16633066 2006 Expression pattern of osteopontin in endometrial carcinoma: correlation with expression of the adhesion molecule CEACAM1.
16632752 2006 Osteopontin and mucosal protection.
16614705 2006 Osteopontin regulation by protein kinase B (Akt) in HepG2 cells.
16571650 2006 Osteopontin is a downstream effector of the PI3-kinase pathway in melanomas that is inversely correlated with functional PTEN.
16533775 2006 An evaluation of tumor oxygenation and gene expression in patients with early stage non-small cell lung cancers.
16512757 2006 No association between selected candidate gene polymorphisms and severe chronic periodontitis.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16489073 2006 Association of S100A4 and osteopontin with specific prognostic factors and survival of patients with minimally invasive breast cancer.
16433860 2006 Sequence variants of the secreted phosphoprotein 1 gene are associated with total serum immunoglobulin E levels in a Japanese population.
16428483 2006 Proteomic-based discovery and characterization of glycosylated eosinophil-derived neurotoxin and COOH-terminal osteopontin fragments for ovarian cancer in urine.
16424021 2006 Increased expression of osteopontin contributes to the progression of prostate cancer.
16381901 2006 The LIFEdb database in 2006.
16373617 2006 High plasma levels of osteopontin in patients with restenosis after percutaneous coronary intervention.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16331611 2006 Prognostic significance of osteopontin expression in human prostate cancer.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16299231 2005 Overexpression of the cytokine osteopontin identifies aggressive laryngeal squamous cell carcinomas and enhances carcinoma cell proliferation and invasiveness.
16208410 2005 Human myeloma cells express the bone regulating gene Runx2/Cbfa1 and produce osteopontin that is involved in angiogenesis in multiple myeloma patients.
16204248 2005 TIS7 regulation of the beta-catenin/Tcf-4 target gene osteopontin (OPN) is histone deacetylase-dependent.
16199891 2005 Comparative proteomic analysis of intra- and interindividual variation in human cerebrospinal fluid.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16166420 2005 Osteopontin expression and prognostic significance in non-small cell lung cancer.
16145474 2005 A polymorphism of the osteopontin gene is related to urinary calcium stones.
16136472 2005 Potential roles of follicular dendritic cell-associated osteopontin in lymphoid follicle pathology and repair and in B cell regulation in HIV-1 and SIV infection.
16100012 2005 Gene expression changes during the development of acute lung injury: role of transforming growth factor beta.
16047475 2005 Nitric oxide-dependent osteopontin expression induces metastatic behavior in HepG2 cells.
16009426 2006 A functional polymorphism in the Eta-1 promoter is associated with allele specific binding to the transcription factor Sp1 and elevated gene expression.
16005200 2005 Distinct structural requirements for binding of the integrins alphavbeta6, alphavbeta3, alphavbeta5, alpha5beta1 and alpha9beta1 to osteopontin.
16000556 2005 Overexpression of osteopontin is associated with more aggressive phenotypes in human non-small cell lung cancer.
15998773 2005 Osteopontin is overexpressed in human papillary thyroid carcinomas and enhances thyroid carcinoma cell invasiveness.
15998376 2005 Regular expression of osteopontin in granular cell tumor: distinctive feature among Schwannian cell tumors.
15993098 2005 Osteopontin is upregulated by BCR-ABL.
15970685 2005 Osteopontin influences the invasiveness of pancreatic cancer cells and is increased in neoplastic and inflammatory conditions.
15956076 2005 Osteopontin is colocalized with the adhesion molecule CEACAM1 in the extravillous trophoblast of the human placenta and enhances invasion of CEACAM1-expressing placental cells.
15954903 2005 Apatite plaque particles in inner medulla of kidneys of calcium oxalate stone formers: osteopontin localization.
15949549 2005 The role of osteopontin in foreign body giant cell formation.
15885319 2005 Osteopontin gene haplotypes correlate with multiple sclerosis development and progression.
15869464 2005 Post-translationally modified residues of native human osteopontin are located in clusters: identification of 36 phosphorylation and five O-glycosylation sites and their biological implications.
15868370 2005 SNPs in the promoter region of the osteopontin gene as a marker predicting the efficacy of interferon-based therapies in patients with chronic hepatitis C.
15863395 2005 Circulating interleukin-18 and osteopontin are useful to evaluate disease activity in patients with tuberculosis.
15857938 2005 Bcr-Abl regulates osteopontin transcription via Ras, PI-3K, aPKC, Raf-1, and MEK.
15855273 2005 Osteopontin functionally activates dendritic cells and induces their differentiation toward a Th1-polarizing phenotype.
15845635 2005 Expression of osteopontin correlates with portal biliary proliferation and fibrosis in biliary atresia.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15776015 2005 Increased expression of osteopontin gene in atypical teratoid/rhabdoid tumor of the central nervous system.
15761492 2005 Role of osteopontin in amplification and perpetuation of rheumatoid synovitis.
15744522 2005 Matrix Gla protein and osteopontin genetic associations with coronary artery calcification and bone density: the CARDIA study.
15742430 2005 Overexpression of osteopontin in rheumatoid synovial mononuclear cells is associated with joint inflammation, not with genetic polymorphism.
15742429 2005 Osteopontin gene polymorphisms in Spanish patients with rheumatoid arthritis.
15731245 2005 The cytokine osteopontin modulates the severity of rotavirus diarrhea.
15712659 2005 Osteopontin expression in proliferated bile ductules: the correlation with liver damage in fulminant hepatitis.
15696579 2005 Phosphorylated osteopontin promotes migration of human choriocarcinoma cells via a p70 S6 kinase-dependent pathway.
15692970 2005 Two single-nucleotide polymorphisms in the 5' and 3' ends of the osteopontin gene contribute to susceptibility to systemic lupus erythematosus.
15579312 2004 Expression and characterization of recombinant osteopontin peptides representing matrix metalloproteinase proteolytic fragments.
15516325 2004 Effect of bone morphogenetic proteins-4, -5 and -6 on DNA synthesis and expression of bone-related proteins in cultured human periodontal ligament cells.
15501463 2004 The role of Osteopontin in tumor metastasis.
15494684 2004 Role of osteopontin in adhesion, migration, cell survival and bone remodeling.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15479859 2004 Polymorphisms in the osteopontin promoter affect its transcriptional activity.
15389974 2004 Adenoviral down-regulation of osteopontin inhibits human osteoclast differentiation in vitro.
15167446 2004 Genetic analysis of 22 candidate genes for hypertension in the Japanese population.
15101999 2004 Decreased expression of osteopontin is related to tumor aggressiveness and clinical outcome of intrahepatic cholangiocarcinoma.
15019804 2004 Osteopontin is up-regulated in human decidual stromal cells.
15014008 2004 Osteopontin but not osteonectin messenger RNA expression is a prognostic marker in curatively resected non-small cell lung cancer.
15004750 2004 Association between IFNA genotype and the risk of sarcoidosis.
15003892 2004 Osteopontin is an adhesive factor for myeloma cells and is found in increased levels in plasma from patients with multiple myeloma.
14996707 2004 Human marrow stromal cells activate monocytes to secrete osteopontin, which down-regulates Notch1 gene expression in CD34+ cells.
14990565 2004 Ets gene PEA3 cooperates with beta-catenin-Lef-1 and c-Jun in regulation of osteopontin transcription.
14988426 2004 Regulation of the osteopontin gene by the orphan nuclear receptor NURR1 in osteoblasts.
14716823 2004 Enhancement of osteopontin expression in HepG2 cells by epidermal growth factor via phosphatidylinositol 3-kinase signaling pathway.
14706653 2004 Genetic polymorphims in promoter region of osteopontin gene may be a marker reflecting hepatitis activity in chronic hepatitis C patients.
14704150 2004 Osteopontin induces AP-1-mediated secretion of urokinase-type plasminogen activator through c-Src-dependent epidermal growth factor receptor transactivation in breast cancer cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14592838 2004 High levels of osteopontin associated with polymorphisms in its gene are a risk factor for development of autoimmunity/lymphoproliferation.
14563350 2003 The role of osteopontin in lung disease.
14534308 2003 Quantitative analysis of platelet alpha v beta 3 binding to osteopontin using laser tweezers.
14524533 2003 Differential expression of osteopontin and bone sialoprotein in bone metastasis of breast and prostate carcinoma.
14517343 2003 Beta(3) integrin expression increases breast carcinoma cell responsiveness to the malignancy-enhancing effects of osteopontin.
12952171 2003 Six genes expressed in bones and teeth encode the current members of the SIBLING family of proteins.
12949055 2003 Osteopontin-dependent CD44v6 expression and cell adhesion in HepG2 cells.
12939547 2003 Osteopontin is released from the heart into the coronary circulation in patients with a previous anterior wall myocardial infarction.
12928913 2003 Osteopontin gene and clinical severity of multiple sclerosis.
12927044 2003 Elevated osteopontin and thrombospondin expression identifies malignant human breast carcinoma but is not indicative of metastatic status.
12879219 2003 Gene polymorphisms, bone mineral density and bone mineral content in young children: the Iowa Bone Development Study.
12847283 2003 Osteopontin (Eta-1) and fibroblast growth factor-2 cross-talk in angiogenesis.
12842452 2003 Distinct gene expression of osteopontin in patients with ulcerative colitis.
12771144 2003 Osteopontin stimulates cell motility and nuclear factor kappaB-mediated secretion of urokinase type plasminogen activator through phosphatidylinositol 3-kinase/Akt signaling pathways in breast cancer cells.
12761568 2003 Osteopontin polymorphisms and disease course in multiple sclerosis.
12706004 2003 The role of osteopontin on calcium oxalate crystal formation.
12650611 2003 Osteopontin and colon cancer progression.
12650610 2003 Transcriptional regulation of osteopontin and the metastatic phenotype: evidence for a Ras-activated enhancer in the human OPN promoter.
12640447 2003 Predicting hepatitis B virus-positive metastatic hepatocellular carcinomas using gene expression profiling and supervised machine learning.
12620651 2003 Genetic polymorphisms of osteopontin in association with multiple sclerosis in Japanese patients.
12606946 2003 Osteopontin-induced migration of human mammary epithelial cells involves activation of EGF receptor and multiple signal transduction pathways.