Property Summary

NCBI Gene PubMed Count 59
PubMed Score 68.39
PubTator Score 36.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.300 2.8e-04
osteosarcoma -1.002 2.5e-04
atypical teratoid / rhabdoid tumor -1.400 1.3e-05
glioblastoma -1.200 2.0e-03
medulloblastoma, large-cell -1.100 6.8e-03
colon cancer -1.200 7.9e-04
breast carcinoma 1.100 2.0e-02
ovarian cancer 2.200 8.6e-07

Synonym

Accession O43791 B2R6S3 D3DTW7 Q53HJ1
Symbols TEF2
BTBD32

Gene

PDB

4EOZ   2CR2   3HQH   3HQI   3HQL   3HQM   3HSV   3HTM   3HU6   3IVB   3IVQ   3IVV   4HS2   4J8Z   4O1V  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (6)

Gene RIF (36)

PMID Text
26527005 SPOP acts as a tumor suppressor by promoting senescence through degrading SENP7.
26505385 Data indicate that a mutation in the SPOP gene may not be associated with breast cancer, particularly in Chinese women.
26344096 Overcoming ERG resistance to SPOP-mediated degradation represents a viable strategy for treatment of prostate cancers expressing either mutated SPOP or truncated ERG.
26344095 SPOP functions as a tumor suppressor to negatively regulate the stability of the ERG oncoprotein in prostate cancer.
26156804 our findings emphasize the critical role of SPOP in the regulation of proliferation and migration in liver cancer
26022775 results suggest that SPOP plays a pivotal role in colorectal cancer (CRC) through mesenchymal-epithelial transition and matrix metalloproteases.
25766326 Our study revealed novel molecular mechanisms underlying the regulation of ERa protein and provided insights in understanding the relationship between SPOP mutations and the development of endometrial cancer.
25351530 SPOP has potential use as novel biomarker of glioma and may serve as an independent predictive factor for prognosis of glioma patients.
25278611 SPOP mutants impaired ubiquitylation of a subset of proteins in a dominant-negative fashion.
25274033 studies highlight the AR axis as the key transcriptional output of SPOP in prostate adenocarcinoma and provide an explanation for the prostate-specific tumor suppressor role of wt-SPOP
25204806 The present study demonstrates that prognosis varies depending on SPOP expression and mutational status, hence, defining a new biotype of PCa associated with a worse prognosis.
25204354 SPOP plays critical roles in suppressing gastric tumorigenesis through inhibiting Hh/Gli2 signaling pathway. It may provide an alternative strategy for developing therapeutic agents of gastric cancer in future.
25058385 SPOP mutations contribute to prostate cancer development by altering the steady-state levels of key components in the androgen-signaling pathway; mutations are also observed in endometrial cancers
24994784 SPOP mutations and novel variants were detected in 5 of 27 aggressive PCa and one of 22 less aggressive PCa
24990631 This study reveals novel molecular events underlying the regulation of DDIT3 protein homeostasis and provides insight in understanding the relationship between SPOP mutations and ER stress dysregulation in prostate cancer.
24845504 miR-145 has a role in post-transcriptional regulation of SPOP expression in selected tissues.
24796539 a novel mutation in SPOP that tracks with prostate cancer within a family and is predicted to be deleterious. Taken together, our results implicate SPOP as a candidate gene for hereditary prostate cancer
24656772 Results indicate that SPOP serves as a regulatory hub to promote ccRCC tumorigenesis.
24563616 the Speckle-Type POZ Protein (SPOP) gene is mutated in prostate cancer in a manner that is not specific for ethnicity, clinical, or pathologic parameters
24508459 Prostate-cancer-associated SPOP mutants cannot bind to and promote androgen receptor degradation.
24072710 Dzip1-dependent stabilization of Spop/HIB is evolutionarily conserved and essential for proper regulation of Gli/Ci proteins in the Hh pathway.
23999291 Crystal structure of the high-order SPOP oligomer is presented depicting a helical organization that could enhance the efficiency of substrate ubiquitination.
23654205 Prevalence of SPOP gene mutation varies depending on cancer types. It is common in prostate cancer and endometrial cancer, and rare in breast cancer, lung cancer, liver cancer, and acute leukemias.
23559371 SPOP plays a critical tumor suppressor role in prostate cancer cells, promoting the turnover of SRC-3 protein and suppressing androgen receptor transcriptional activity.
23216165 Loss of expression of SPOP gene might play a role in cancer pathogenesis by altering tumor suppressor gene functions of SPOP.
22632832 Adaptor protein self-assembly provides a graded level of regulation of the SPOP/Cul3 E3 ligase toward its multiple protein substrates.
22085717 These results suggest that the novel regulatory mechanism of BRMS1 by Cul3-SPOP complex is important for breast cancer progression.
21577200 SPOP expression inhibited SRC-3-mediated oncogenic signaling and tumorigenesis.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19818708 The study provides a molecular understanding of how SPOP and other MATH-BTB proteins recruit substrates to Cul3 and how their dimerization and conformational variability may facilitate avid interactions with diverse substrates.
19164706 study found that SPOP plays a conserved role in TNF-mediated JNK signaling and was highly expressed in 99% of clear cell renal cell carcinomas
18997279 The study first proposes the proapoptotic aspect of the BTB/POZ domain of SPOP protein based on the finding that cells expressing the C-terminal fragment of SPOP containing the BTB/POZ domain underwent apoptosis.
18218622 define a novel mechanism whereby the phosphoinositide phosphatidylinositol 5-phosphate leads to stimulation of Cul3-SPOP ubiquitin ligase activity
16524876 SPOP/Cul3-ubiquitin ligase plays an essential role in the control of Daxx level and, thus, in the regulation of Daxx-mediated cellular processes, including transcriptional regulation and apoptosis
15897469 Here, we report that the E3 ubiquitin ligase consisting of SPOP and CULLIN3 is able to ubiquitinate the Polycomb group protein BMI1.
15240113 Mutagenesis study suggests that the ability of SPOP to self-associate as well as its ability to bind with Daxx was important for the modulation of Daxx-mediated transcriptional repression.

AA Sequence

MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLR      1 - 70
VNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRD     71 - 140
FLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQE    141 - 210
FQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKY    211 - 280
ALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVA    281 - 350
EAYRSLASAQCPFLGPPRKRLKQS                                                  351 - 374
//

Text Mined References (60)

PMID Year Title
26527005 2015 SPOP E3 Ubiquitin Ligase Adaptor Promotes Cellular Senescence by Degrading the SENP7 deSUMOylase.
26505385 2015 Relationship between SPOP mutation and breast cancer in Chinese population.
26344096 2015 Truncated ERG Oncoproteins from TMPRSS2-ERG Fusions Are Resistant to SPOP-Mediated Proteasome Degradation.
26344095 2015 SPOP Promotes Ubiquitination and Degradation of the ERG Oncoprotein to Suppress Prostate Cancer Progression.
26156804 2015 Speckle-type POZ protein is negatively associated with malignancies and inhibits cell proliferation and migration in liver cancer.
26022775 2015 Properties and Clinical Relevance of Speckle-Type POZ Protein in Human Colorectal Cancer.
25766326 2015 Endometrial cancer-associated mutants of SPOP are defective in regulating estrogen receptor-? protein turnover.
25351530 2015 Decreased expression of the SPOP gene is associated with poor prognosis in glioma.
25278611 2014 Prostate cancer. Ubiquitylome analysis identifies dysregulation of effector substrates in SPOP-mutant prostate cancer.
25274033 2014 Androgen receptor is the key transcriptional mediator of the tumor suppressor SPOP in prostate cancer.
25204806 2014 Clinico-pathological significance of the molecular alterations of the SPOP gene in prostate cancer.
25204354 2014 SPOP suppresses tumorigenesis by regulating Hedgehog/Gli2 signaling pathway in gastric cancer.
25058385 2014 The emerging role of speckle-type POZ protein (SPOP) in cancer development.
24994784 Identification of speckle-type POZ protein somatic mutations in African American prostate cancer.
24990631 2014 Destruction of DDIT3/CHOP protein by wild-type SPOP but not prostate cancer-associated mutants.
24845504 2014 Differential expression of speckled POZ protein, SPOP: putative regulation by miR-145.
24796539 2014 Identification of a novel germline SPOP mutation in a family with hereditary prostate cancer.
24656772 2014 SPOP promotes tumorigenesis by acting as a key regulatory hub in kidney cancer.
24563616 2014 SPOP mutations in prostate cancer across demographically diverse patient cohorts.
24508459 2014 Destruction of full-length androgen receptor by wild-type SPOP, but not prostate-cancer-associated mutants.
24072710 2013 Stabilization of speckle-type POZ protein (Spop) by Daz interacting protein 1 (Dzip1) is essential for Gli turnover and the proper output of Hedgehog signaling.
23999291 2013 Structural basis of high-order oligomerization of the cullin-3 adaptor SPOP.
23654205 2014 Somatic mutation of SPOP tumor suppressor gene is rare in breast, lung, liver cancers, and acute leukemias.
23559371 2013 Prostate cancer-associated mutations in speckle-type POZ protein (SPOP) regulate steroid receptor coactivator 3 protein turnover.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23216165 2013 Mutational and expressional analyses of SPOP, a candidate tumor suppressor gene, in prostate, gastric and colorectal cancers.
22632832 2012 Adaptor protein self-assembly drives the control of a cullin-RING ubiquitin ligase.
22085717 2011 Breast cancer metastasis suppressor 1 (BRMS1) is destabilized by the Cul3-SPOP E3 ubiquitin ligase complex.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21577200 2011 Tumor-suppressor role for the SPOP ubiquitin ligase in signal-dependent proteolysis of the oncogenic co-activator SRC-3/AIB1.
21573799 2012 FTH1 binds to Daxx and inhibits Daxx-mediated cell apoptosis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19818708 2009 Structures of SPOP-substrate complexes: insights into molecular architectures of BTB-Cul3 ubiquitin ligases.
19164706 2009 Analysis of Drosophila segmentation network identifies a JNK pathway factor overexpressed in kidney cancer.
18997279 2007 BTB/POZ domain of speckle-type POZ protein (SPOP) confers proapoptotic function in HeLa cells.
18218622 2008 Coordinated activation of the nuclear ubiquitin ligase Cul3-SPOP by the generation of phosphatidylinositol 5-phosphate.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16740475 2006 A hedgehog-induced BTB protein modulates hedgehog signaling by degrading Ci/Gli transcription factor.
16651542 2006 Roadkill attenuates Hedgehog responses through degradation of Cubitus interruptus.
16524876 2006 BTB domain-containing speckle-type POZ protein (SPOP) serves as an adaptor of Daxx for ubiquitination by Cul3-based ubiquitin ligase.
16381901 2006 The LIFEdb database in 2006.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15897469 2005 Stable X chromosome inactivation involves the PRC1 Polycomb complex and requires histone MACROH2A1 and the CULLIN3/SPOP ubiquitin E3 ligase.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15240113 2004 Daxx-mediated transcriptional repression of MMP1 gene is reversed by SPOP.
15121856 2004 Identification of PCIF1, a POZ domain protein that inhibits PDX-1 (MODY4) transcriptional activity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14528312 2003 Targeting of protein ubiquitination by BTB-Cullin 3-Roc1 ubiquitin ligases.
12740575 2003 NKG2D-DAP10 triggers human NK cell-mediated killing via a Syk-independent regulatory pathway.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12426565 2002 Selective associations with signaling proteins determine stimulatory versus costimulatory activity of NKG2D.
12426564 2002 NKG2D recruits two distinct adapters to trigger NK cell activation and costimulation.
12183056 2002 MacroH2A1.2 binds the nuclear protein Spop.
11279055 2001 A diverse family of proteins containing tumor necrosis factor receptor-associated factor domains.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10426994 1999 An activating immunoreceptor complex formed by NKG2D and DAP10.
9414087 1997 Identification of a novel nuclear speckle-type protein, SPOP.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.