Property Summary

NCBI Gene PubMed Count 71
PubMed Score 83.78
PubTator Score 36.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Endometrial Neoplasms 55 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.4
DOID:9917 31 0.0 1.2
Endometrial cancer 311 0.0 0.8
Disease Target Count Z-score Confidence
Prostate cancer 175 4.588 2.3

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 1.3e-05
breast carcinoma 1.100 2.0e-02
colon cancer -1.200 7.9e-04
glioblastoma -1.200 2.0e-03
medulloblastoma, large-cell -1.100 6.8e-03
osteosarcoma -1.002 2.5e-04
ovarian cancer -1.600 2.5e-06
psoriasis -1.300 2.8e-04

Protein-protein Interaction (1)

PDB (15)

Gene RIF (47)

AA Sequence

MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLR      1 - 70
VNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRD     71 - 140
FLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQE    141 - 210
FQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKY    211 - 280
ALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVA    281 - 350
EAYRSLASAQCPFLGPPRKRLKQS                                                  351 - 374
//

Text Mined References (72)

PMID Year Title