Property Summary

NCBI Gene PubMed Count 21
PubMed Score 49.28
PubTator Score 20.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
interstitial lung disease 1.100 3.5e-02
psoriasis -1.100 1.1e-06
group 3 medulloblastoma 2.300 1.9e-03
adrenocortical carcinoma -1.943 7.4e-05
chronic kidney disease 1.500 1.8e-02
primary pancreatic ductal adenocarcinoma 2.259 3.0e-04
intraductal papillary-mucinous adenoma (... -1.100 4.9e-03
intraductal papillary-mucinous carcinoma... -1.200 1.2e-02
intraductal papillary-mucinous neoplasm ... -1.100 3.9e-02
Hydrolethalus syndrome -2.890 2.3e-02
interstitial cystitis 1.500 1.0e-03
cystic fibrosis -1.600 6.9e-04
acute myeloid leukemia -1.300 3.1e-02
Endometriosis 1.098 2.9e-02
Breast cancer 1.600 1.6e-03
gastric carcinoma 2.100 1.1e-02
ulcerative colitis 1.700 2.7e-04
ovarian cancer 1.700 8.4e-04
pancreatic cancer 2.700 5.6e-05
type I diabetes mellitus -1.242 1.4e-02

Gene RIF (8)

PMID Text
25945835 Data suggest that spondin-2 could be an independent diagnostic and prognostic biomarker of colon cancer.
25751394 Mindin protects against vascular hyperplasia by suppression of abnormal VSMC proliferation, migration and phenotypic switching in an AKT-dependent manner.
22615945 Using tissue microarray by immunohistostaining, we found SPON2 to be over-expressed in prostate cancer (PCa). SPON2 staining was more intense in Gleason score sum 7-8 and in PCa patients with metastasis.
21632881 mindin serves as a novel mediator that protects against cardiac hypertrophy and the transition to heart failure by blocking AKT/GSK3beta and TGF-beta1-Smad signalling.
21098016 High Mindin is associated with diabetic nephropathy in type 2 diabetes.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19903741 Spondin 2, which is regulated by T(3), has an important role in cell invasion, cell migration, and hepatoma tumor progression.
19153605 The structure of the F-spondin domain of mindin was determined at 1.8-A resolution.

AA Sequence

MENPSPAAALGKALCALLLATLGAAGQPLGGESICSARALAKYSITFTGKWSQTAFPKQYPLFRPPAQWS      1 - 70
SLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSVHEVFSAPAVPSGTGQTSAEL     71 - 140
EVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTV    141 - 210
TEITSSSPSHPANSFYYPRLKALPPIARVTLVRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEV    211 - 280
SLWSSWGLCGGHCGRLGTKSRTRYVRVQPANNGSPCPELEEEAECVPDNCV                       281 - 331
//

Text Mined References (22)

PMID Year Title
25945835 2015 Upregulation of spondin-2 predicts poor survival of colorectal carcinoma patients.
25751394 2015 Mindin regulates vascular smooth muscle cell phenotype and prevents neointima formation.
25416956 2014 A proteome-scale map of the human interactome network.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22615945 2012 Spondin-2 (SPON2), a more prostate-cancer-specific diagnostic biomarker.
21632881 2011 Cardiac-specific mindin overexpression attenuates cardiac hypertrophy via blocking AKT/GSK3? and TGF-?1-Smad signalling.
21098016 2011 Mindin: a novel marker for podocyte injury in diabetic nephropathy.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19903741 2010 Positive regulation of spondin 2 by thyroid hormone is associated with cell migration and invasion.
19153605 2009 Structure of the F-spondin domain of mindin, an integrin ligand and pattern recognition molecule.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18239089 2008 Sequence variants in the RNF212 gene associate with genome-wide recombination rate.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15094111 2004 The neuronal class 2 TSR proteins F-spondin and Mindin: a small family with divergent biological activities.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10512675 1999 Identification of genes (SPON2 and C20orf2) differentially expressed between cancerous and noncancerous lung cells by mRNA differential display.