Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.48
PubTator Score 5.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma -3.000 3.0e-02
ependymoma -4.900 8.4e-28
oligodendroglioma -2.600 1.5e-09
glioblastoma -4.400 1.5e-06
sonic hedgehog group medulloblastoma -4.000 4.0e-06
cystic fibrosis 1.086 6.7e-05
atypical teratoid/rhabdoid tumor -4.100 2.5e-09
medulloblastoma, large-cell -4.500 1.1e-05
primitive neuroectodermal tumor -3.000 6.9e-03
interstitial cystitis -2.800 1.9e-03
pediatric high grade glioma -4.200 1.3e-08
pilocytic astrocytoma -3.300 4.8e-05
subependymal giant cell astrocytoma -4.523 1.9e-03
Pick disease -1.600 1.9e-02
progressive supranuclear palsy -1.800 1.0e-02
Breast cancer -1.500 3.0e-58
ovarian cancer -2.000 2.5e-03
pituitary cancer 4.000 1.4e-03
Down syndrome 1.300 3.7e-03

Gene RIF (4)

PMID Text
25648963 associations, near SPOCK3 were identified and other putative modulators of memory performance were revealed by a
24292267 The results of this study suggest that SPOCK3 may modify the genetic risk for Attention-deficit/hyperactivity disorder and personality disorders
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19144404 High expression of testican 3 is associated with adult T-cell leukemia.

AA Sequence

MLKVSAVLCVCAAAWCSQSLAAAAAVAAAGGRSDGGNFLDDKQWLTTISQYDKEVGQWNKFRDEVEDDYF      1 - 70
RTWSPGKPFDQALDPAKDPCLKMKCSRHKVCIAQDSQTAVCISHRRLTHRMKEAGVDHRQWRGPILSTCK     71 - 140
QCPVVYPSPVCGSDGHTYSFQCKLEYQACVLGKQISVKCEGHCPCPSDKPTSTSRNVKRACSDLEFREVA    141 - 210
NRLRDWFKALHESGSQNKKTKTLLRPERSRFDTSILPICKDSLGWMFNRLDTNYDLLLDQSELRSIYLDK    211 - 280
NEQCTKAFFNSCDTYKDSLISNNEWCYCFQRQQDPPCQTELSNIQKRQGVKKLLGQYIPLCDEDGYYKPT    281 - 350
QCHGSVGQCWCVDRYGNEVMGSRINGVADCAIDFEISGDFASGDFHEWTDDEDDEDDIMNDEDEIEDDDE    351 - 420
DEGDDDDGGDDHDVYI                                                          421 - 436
//

Text Mined References (14)

PMID Year Title
25648963 2015 Genome-wide studies of verbal declarative memory in nondemented older people: the Cohorts for Heart and Aging Research in Genomic Epidemiology consortium.
24292267 2014 SPOCK3, a risk gene for adult ADHD and personality disorders.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19144404 2009 Testican 3 expression in adult T-cell leukemia.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12810672 2003 Testican 2 abrogates inhibition of membrane-type matrix metalloproteinases by other testican family proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11751414 2001 Suppression of membrane-type 1 matrix metalloproteinase (MMP)-mediated MMP-2 activation and tumor invasion by testican 3 and its splicing variant gene product, N-Tes.