Property Summary

NCBI Gene PubMed Count 27
PubMed Score 93.74
PubTator Score 33.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma -5.200 5.2e-10
astrocytic glioma -1.600 1.7e-02
glioblastoma -2.800 2.6e-03
oligodendroglioma -1.100 3.1e-05
osteosarcoma 2.286 1.3e-02
posterior fossa group B ependymoma -3.800 1.0e-09
sonic hedgehog group medulloblastoma -1.700 1.0e-03
atypical teratoid / rhabdoid tumor -3.400 4.7e-08
medulloblastoma, large-cell -3.600 1.6e-04
primary pancreatic ductal adenocarcinoma 1.468 1.8e-02
non-small cell lung cancer 2.567 2.1e-15
lung cancer 3.200 1.7e-06
pancreatic cancer 1.700 7.7e-03
pediatric high grade glioma -2.500 4.3e-04
subependymal giant cell astrocytoma -2.600 2.9e-02
Pick disease -1.500 7.3e-03
Breast cancer 2.300 7.3e-10
ovarian cancer -5.200 4.5e-19
pituitary cancer 2.700 3.6e-05

Gene RIF (11)

PMID Text
26638890 SPOCK1 is highly expressed in ovarian cancer.SPOCK1 contributes to ovarian cancer development and metastasis.
26138584 Collectively, altered expression of PKP1 and SPOCK1 appears to be a frequent and critical event in prostate cancer
26077618 These results suggest that up-regulation of SPOCK1 in ESCC induces EMT, thus promotes migration and invasion in ESCC cells.
25623055 SPOCK1 activates PI3K/Akt signaling.
24134845 this study showed that SPOCK1 is a novel metastasis related biomarker in lung cancer and may be new diagnostic and therapeutic target for lung cancer.
23873022 Testican-1-induced EMT signaling.
23022495 In the present study, we showed that SPOCK1 could inhibit apoptosis and promote cancer invasion.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19282985 SPOCK gene underlies variation of age at menarche
19282985 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16596217 Significant overexpression of osteonectin mRNA is associated with pancreatic cancer

AA Sequence

MPAIAVLAAAAAAWCFLQVESRHLDALAGGAGPNHGNFLDNDQWLSTVSQYDRDKYWNRFRDDDYFRNWN      1 - 70
PNKPFDQALDPSKDPCLKVKCSPHKVCVTQDYQTALCVSRKHLLPRQKKGNVAQKHWVGPSNLVKCKPCP     71 - 140
VAQSAMVCGSDGHSYTSKCKLEFHACSTGKSLATLCDGPCPCLPEPEPPKHKAERSACTDKELRNLASRL    141 - 210
KDWFGALHEDANRVIKPTSSNTAQGRFDTSILPICKDSLGWMFNKLDMNYDLLLDPSEINAIYLDKYEPC    211 - 280
IKPLFNSCDSFKDGKLSNNEWCYCFQKPGGLPCQNEMNRIQKLSKGKSLLGAFIPRCNEEGYYKATQCHG    281 - 350
STGQCWCVDKYGNELAGSRKQGAVSCEEEQETSGDFGSGGSVVLLDDLEYERELGPKDKEGKLRVHTRAV    351 - 420
TEDDEDEDDDKEDEVGYIW                                                       421 - 439
//

Text Mined References (30)

PMID Year Title
26638890 2015 Effects of shRNA-mediated knockdown of SPOCK1 on ovarian cancer growth and metastasis.
26138584 2015 Plakophilin 1-deficient cells upregulate SPOCK1: implications for prostate cancer progression.
26077618 2015 Up-regulation of SPOCK1 induces epithelial-mesenchymal transition and promotes migration and invasion in esophageal squamous cell carcinoma.
25623055 2015 SPOCK1 as a potential cancer prognostic marker promotes the proliferation and metastasis of gallbladder cancer cells by activating the PI3K/AKT pathway.
24134845 2013 SPOCK1 is a novel transforming growth factor-? target gene that regulates lung cancer cell epithelial-mesenchymal transition.
23897914 2013 A genome-wide association study (GWAS) for bronchopulmonary dysplasia.
23873022 2014 Testican-1-mediated epithelial-mesenchymal transition signaling confers acquired resistance to lapatinib in HER2-positive gastric cancer.
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
23022495 2013 SPOCK1 is regulated by CHD1L and blocks apoptosis and promotes HCC cell invasiveness and metastasis in mice.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19282985 2009 Genome-wide association analyses identify SPOCK as a key novel gene underlying age at menarche.
16596217 2006 Significant overexpression of SPARC/osteonectin mRNA in pancreatic cancer compared to cancer of the papilla of Vater.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14511383 2003 Human proteoglycan testican-1 inhibits the lysosomal cysteine protease cathepsin L.
12853036 2003 Testican-1 inhibits attachment of Neuro-2a cells.
12810672 2003 Testican 2 abrogates inhibition of membrane-type matrix metalloproteinases by other testican family proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11751414 2001 Suppression of membrane-type 1 matrix metalloproteinase (MMP)-mediated MMP-2 activation and tumor invasion by testican 3 and its splicing variant gene product, N-Tes.
11355883 2001 Testican in human blood.
11131125 2000 Distribution of testican expression in human brain.
9545645 1998 Genomic organization of the human SPOCK gene and its chromosomal localization to 5q31.
9323035 1997 Properties of the extracellular calcium binding module of the proteoglycan testican.
9272383 1997 Endothelial cell expression of testican mRNA.
9181134 1997 [Cloning of testican/SPOCK in man and mouse. Neuromuscular expression perspectives in pathology].
8626787 1996 Structure and cellular distribution of mouse brain testican. Association with the postsynaptic area of hippocampus pyramidal cells.
8389704 1993 Testican, a multidomain testicular proteoglycan resembling modulators of cell social behaviour.
7507743 1994 Proteoglycans in male reproductive tract.
1463459 1992 Characterization of a human seminal plasma glycosaminoglycan-bearing polypeptide.