Property Summary

NCBI Gene PubMed Count 33
PubMed Score 104.64
PubTator Score 33.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -2.200 4.4e-04
astrocytic glioma -1.600 1.7e-02
atypical teratoid / rhabdoid tumor -3.400 4.7e-08
Breast cancer 2.300 7.3e-10
ependymoma -3.400 3.0e-10
glioblastoma -2.300 1.4e-04
lung cancer 2.500 1.9e-04
malignant mesothelioma -5.200 5.2e-10
medulloblastoma -1.400 2.6e-03
medulloblastoma, large-cell -3.600 1.6e-04
non-small cell lung cancer 2.567 2.1e-15
oligodendroglioma -1.100 3.1e-05
osteosarcoma 2.286 1.3e-02
ovarian cancer -5.200 4.5e-19
pancreatic cancer 1.100 3.5e-03
Pick disease -1.500 7.3e-03
pituitary cancer 2.700 3.6e-05
primary pancreatic ductal adenocarcinoma 1.468 1.8e-02
subependymal giant cell astrocytoma -2.600 2.9e-02

Gene RIF (17)

AA Sequence

MPAIAVLAAAAAAWCFLQVESRHLDALAGGAGPNHGNFLDNDQWLSTVSQYDRDKYWNRFRDDDYFRNWN      1 - 70
PNKPFDQALDPSKDPCLKVKCSPHKVCVTQDYQTALCVSRKHLLPRQKKGNVAQKHWVGPSNLVKCKPCP     71 - 140
VAQSAMVCGSDGHSYTSKCKLEFHACSTGKSLATLCDGPCPCLPEPEPPKHKAERSACTDKELRNLASRL    141 - 210
KDWFGALHEDANRVIKPTSSNTAQGRFDTSILPICKDSLGWMFNKLDMNYDLLLDPSEINAIYLDKYEPC    211 - 280
IKPLFNSCDSFKDGKLSNNEWCYCFQKPGGLPCQNEMNRIQKLSKGKSLLGAFIPRCNEEGYYKATQCHG    281 - 350
STGQCWCVDKYGNELAGSRKQGAVSCEEEQETSGDFGSGGSVVLLDDLEYERELGPKDKEGKLRVHTRAV    351 - 420
TEDDEDEDDDKEDEVGYIW                                                       421 - 439
//

Text Mined References (36)

PMID Year Title