Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.72
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Astrocytoma, Pilocytic 3081 9.7e-06
adult high grade glioma 3801 2.1e-03
breast carcinoma 1638 3.8e-03
glioblastoma 5792 5.0e-03
inflammatory breast cancer 286 7.0e-03
ependymoma 4679 7.7e-03
osteosarcoma 7950 2.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma 1.400 2.1e-03
Astrocytoma, Pilocytic 1.800 9.7e-06
breast carcinoma 1.600 3.8e-03
ependymoma 1.100 7.7e-03
glioblastoma 1.500 5.0e-03
inflammatory breast cancer 1.700 7.0e-03
osteosarcoma 1.517 2.4e-02

Gene RIF (2)

AA Sequence

MSQAGDVEGPSTGDPVLSPQHNCELLQNMEGASSMPGLSPDGPGASSGPGVRAGSRRKIPRKEALRGGSS      1 - 70
RAAGAAEVRPGVLELLAVVQSRGSMLAPGLHMQLPSVPTQGRALTSKRLQVSLCDILDDSCPRKLCSRSA     71 - 140
GLPERALACRERLAGVEEVSCLRPREARDGGMSSPGCDRRSPTLSKEEPPGRPLTSSPDPVPVRVRKKWR    141 - 210
RQGAHSECEEGAGDFLWLDQSPRGDNLLSVGDPPQVADLESLGGPCRPPSPKDTGSGPGEPGGSGAGCAS    211 - 280
GTEKFGYLPATGDGPQPGSPCGPVGFPVPSGGESLSSAAQAPPQSAALCLGASAQASAEQQEAVCVVRTG    281 - 350
SDEGQAPAQDQEELEAKAQPASRGRLEQGLAAPADTCASSREPLGGLSSSLDTEASRACSGPFMEQRRSK    351 - 420
GTKNLKKGPVPCAQDRGTDRSSDNSHQDRPEEPSPGGCPRLEEVKIPHGVKLVCYLGSGPVIQLLGAISH    421 - 490
GQAGGQLPPKLEVLEDLMEVSSPSPAQRLRRKKRPMVQGPAGCQVFQPSPSGGTAGDPGGLSDPFYPPRS    491 - 560
GSLALGDPSSDPACSQSGPMEAEEDSLPEQPEDSAQLQQEKPSLYIGVRGTVVRSMQEVLWTRLRELPDP    561 - 630
VLSEEVVEGIAAGIEAALWDLTQGTNGRYKTKYRSLLFNLRDPRNLDLFLKVVHGDVTPYDLVRMSSMQL    631 - 700
APQELARWRDQEEKRGLNIIEQQQKEPCRLPASKMTHKGEVEIQRDMDQTLTLEDLVGPQMFMDCSPQAL    701 - 770
PIASEDTTGQHDHHFLDPNCHICKDWEPSNELLGSFEAAKSCGDNIFQKALSQTPMPAPEMPKTRELSPT    771 - 840
EPQDRVPPSGLHVPAAPTKALPCLPPWEGVLDMFSIKRFRARAQLVSGHSCRLVQALPTVIRSAGCIPSN    841 - 910
IVWDLLASICPAKAKDVCVVRLCPHGARDTQNCRLLYSYLNDRQRHGLASVEHMGMVLLPLPAFQPLPTR    911 - 980
LRPLGGPGLWALPVSPLLSPGLEVTHSSLLLAVLLPKEGLPDTAGSSPWLGKVQKMVSFNSKVEKRYYQP    981 - 1050
DDRRPNVPLKGTPPPGGAWQQSQGRGSIAPRGISAWQRPPRGRGRLWPEPENWQHPGRGQWPPEPGLRQS   1051 - 1120
QHPYSVAPAGHGFGRGQHFHRDSCPHQALLRHLESLATMSHQLQALLCPQTKSSIPRPLQRLSSALAAPE   1121 - 1190
PPGPARDSSLGPTDEAGSECPFPRKA                                               1191 - 1216
//

Text Mined References (10)

PMID Year Title