Property Summary

NCBI Gene PubMed Count 18
PubMed Score 7.55
PubTator Score 7.69

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
oligodendroglioma 1.900 2.0e-03
osteosarcoma 2.376 3.5e-05
atypical teratoid / rhabdoid tumor -1.600 8.2e-06
glioblastoma 1.100 2.1e-02
medulloblastoma, large-cell -1.600 7.5e-07
tuberculosis -1.100 3.0e-05
active ulcerative colitis 1.384 4.5e-02
group 4 medulloblastoma 1.100 1.8e-02
aldosterone-producing adenoma -1.104 1.7e-02
ovarian cancer -1.500 2.6e-03

Gene RIF (9)

PMID Text
26668326 Data suggest formin homology domain (FH2) of Fmn2 binds actin at filament barbed end as weak capper and plays a role in displacing WASP homology domain 2 (WH2) domains of Spire-1 from actin; competitive binding of Fmn2 vs Spire-1 aids actin assembly.
26305500 The authors propose Spire1C isoform cooperates with INF2 to regulate actin assembly at endoplasmic reticulum-mitochondrial contacts.
26287480 This DNA damage-induced nuclear actin assembly requires two biologically and physically linked nucleation factors: Formin-2 and Spire-1/Spire-2.
24586110 Spire recruits Fmn2 and facilitates its association with actin filaments barbed ends.
24213528 Spire-1 is specifically recruited at invadosomes and is part of a multi-molecular complex containing Src kinase, the formin mDia1 and actin.
21705804 analysis of the molecular basis of the Spir1/formin-2 interaction
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19605360 both mammalian Spir proteins, Spir-1 and Spir-2, interact with mammalian Fmn subgroup proteins formin-1 and formin-2
18042452 The multifunctional character of the WH2 domains allows Spire to sequester four G-actin subunits binding cooperatively in a tight SA(4) complex and to nucleate, sever, and cap filaments at their barbed ends.

AA Sequence

MAQAAGPAGGGEPRTEAVGGEGPREPGAAGGAAGGSRDALSLEEILRLYNQPINEEQAWAVCYQCCGSLR      1 - 70
AAARRRQPRHRVRSAAQIRVWRDGAVTLAPAADDAGEPPPVAGKLGYSQCMETEVIESLGIIIYKALDYG     71 - 140
LKENEERELSPPLEQLIDHMANTVEADGSNDEGYEAAEEGLGDEDEKRKISAIRSYRDVMKLCAAHLPTE    141 - 210
SDAPNHYQAVCRALFAETMELHTFLTKIKSAKENLKKIQEMEKSDESSTDLEELKNADWARFWVQVMRDL    211 - 280
RNGVKLKKVQERQYNPLPIEYQLTPYEMLMDDIRCKRYTLRKVMVNGDIPPRLKKSAHEIILDFIRSRPP    281 - 350
LNPVSARKLKPTPPRPRSLHERILEEIKAERKLRPVSPEEIRRSRLAMRPLSMSYSFDLSDVTTPESTKN    351 - 420
LVESSMVNGGLTSQTKENGLSTSQQVPAQRKKLLRAPTLAELDSSESEEETLHKSTSSSSVSPSFPEEPV    421 - 490
LEAVSTRKKPPKFLPISSTPQPERRQPPQRRHSIEKETPTNVRQFLPPSRQSSRSLEEFCYPVECLALTV    491 - 560
EEVMHIRQVLVKAELEKYQQYKDIYTALKKGKLCFCCRTRRFSFFTWSYTCQFCKRPVCSQCCKKMRLPS    561 - 630
KPYSTLPIFSLGPSALQRGESSMRSEKPSTAHHRPLRSIARFSSKSKSMDKSDEELQFPKELMEDWSTME    631 - 700
VCVDCKKFISEIISSSRRSLVLANKRARLKRKTQSFYMSSPGPSEYCPSERTISEI                  701 - 756
//

Text Mined References (26)

PMID Year Title
26668326 2016 Role of the C-terminal Extension of Formin 2 in Its Activation by Spire Protein and Processive Assembly of Actin Filaments.
26644512 2015 The polarity protein Inturned links NPHP4 to Daam1 to control the subapical actin network in multiciliated cells.
26305500 2015 A mitochondria-anchored isoform of the actin-nucleating spire protein regulates mitochondrial division.
26287480 2015 DNA damage induces nuclear actin filament assembly by Formin -2 and Spire-½ that promotes efficient DNA repair. [corrected].
24586110 2014 Spire and Formin 2 synergize and antagonize in regulating actin assembly in meiosis by a ping-pong mechanism.
24213528 2014 Spire-1 contributes to the invadosome and its associated invasive properties.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22542470 2012 Genome-wide association study of antibody response to smallpox vaccine.
21730168 2011 Structure and function of the interacting domains of Spire and Fmn-family formins.
21705804 2011 Molecular basis of actin nucleation factor cooperativity: crystal structure of the Spir-1 kinase non-catalytic C-lobe domain (KIND)•formin-2 formin SPIR interaction motif (FSI) complex.
21620703 2011 Spire-type actin nucleators cooperate with Formin-2 to drive asymmetric oocyte division.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19605360 2009 Identification of a short Spir interaction sequence at the C-terminal end of formin subgroup proteins.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18042452 2007 Analysis of the function of Spire in actin assembly and its synergy with formin and profilin.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11747823 2001 The Spir actin organizers are involved in vesicle transport processes.
10574461 1999 Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain.