Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 7.5e-07

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.700 7.5e-07

Gene RIF (1)

AA Sequence

MKGICSDAILVLATSMWMAFAIDFPLPMASERGQLDKTIVECLKNVNKCWFLSYIKPSEPICGSDQVTYS      1 - 70
SDCHLCSKILFEGLNITKLYDGQCENS                                                71 - 97
//

Text Mined References (5)

PMID Year Title