Property Summary

NCBI Gene PubMed Count 18
PubMed Score 40.97
PubTator Score 50.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Multiple Sclerosis 498 2.8e-03
nasopharyngeal carcinoma 1056 8.7e-03
Disease Target Count Z-score Confidence
Esophageal cancer 30 4.741 2.4

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple Sclerosis 2.000 2.8e-03
nasopharyngeal carcinoma -1.400 8.7e-03

Gene RIF (18)

PMID Text
22528291 Conformational study of ECRG2 using NMR.
22315007 miR-1322 can regulate ECRG2 in an allele-specific manner and that serum levels of miR-1322 can serve as a potential diagnostic biomarker for patients with ESCC.
21042721 ECRG2 is a novel member of the Kazal-type serine protease inhibitor family and may function as a tumor suppressor gene regulating the protease cascades during carcinogenesis and invasion of esophageal cancer.
19796867 ECRG2 regulates invasion/migration partly through ECM degradation and uPA/uPAR/FPRL1 pathway
19717562 ECRG2 is involved in the regulation of cell migration/invasion through uPA/uPAR/beta1 integrin pathway.
18824154 uPA-binding loops of ECRG2 are in correspondence with the reactive site loops for binding of serine proteinase in turkey ovomucoid third domain (OMTKY3).
18618216 the ECRG2 TCA (3)/TCA (4) genotype is associated with the risk of oesophageal carcinoma in a North Indian population.
18618216 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18162463 ECRG2 is important for ensuring centrosome duplication, spindle assembly checkpoint, and accurate chromosome segregation, and its depletion may contribute to chromosome instability and aneuploidy in human cancers.
17693286 Observational study of gene-disease association. (HuGE Navigator)
17693286 genetically fixed short tandem repeat polymorphism TCA3/TCA3 in exon 4 of ECRG2 is associated with poor clinical outcome in surgically treated esophageal cancer patients and might be a potential prognostic marker
17602171 results suggest that ECRG2 inhibits aggressiveness of cancer cell, possibly through the down-regulation of uPA/plasmin activity
17418617 Short tandem repeat polymorphism TCA3/TCA3 in exon 4 of ECRG2 is associated with poor relapse-free survival in surgically completely resected oral squamous cell carcinoma patients and might be a potential prognostic marker
17352218 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
14639608 Observational study of gene-disease association. (HuGE Navigator)
14639608 Short tandem repeat polymorphism in a novel esophageal cancer-related gene (ECRG2) implicates susceptibility to esophageal cancer
12970870 Potential interaction partner for ECRG2 might be involved in regulation of cell proliferation and apoptosis and in various physiological processes.
12646258 Data suggest that the physical interaction of esophageal cancer related gene 2 (ECRG2) and metallothionein 2A (MT2A) may play an important role in the carcinogenesis of esophageal cancer.

AA Sequence

MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTES      1 - 70
LKSNGRVQFLHDGSC                                                            71 - 85
//

Text Mined References (18)

PMID Year Title
22528291 2012 NMR structure note: human esophageal cancer-related gene 2.
22315007 2013 MicroRNA-1322 regulates ECRG2 allele specifically and acts as a potential biomarker in patients with esophageal squamous cell carcinoma.
21042721 2010 Molecular cloning and characterization of a novel esophageal cancer related gene.
19796867 2010 ECRG2 regulates ECM degradation and uPAR/FPRL1 pathway contributing cell invasion/migration.
19717562 2009 ECRG2 regulates cell migration/invasion through urokinase-type plasmin activator receptor (uPAR)/beta1 integrin pathway.
18824154 2008 Mapping the putative binding site for uPA protein in Esophageal Cancer-Related Gene 2 by heteronuclear NMR method.
18618216 2008 Association of ECRG2 TCA short tandem repeat polymorphism with the risk of oesophageal cancer in a North Indian population.
18162463 2008 ECRG2 disruption leads to centrosome amplification and spindle checkpoint defects contributing chromosome instability.
17693286 2007 Short tandem repeat polymorphism in exon 4 of esophageal cancer-related gene 2 detected in genomic DNA is a prognostic marker for esophageal cancer.
17602171 2007 ECRG2 inhibits cancer cell migration, invasion and metastasis through the down-regulation of uPA/plasmin activity.
17418617 2008 Short tandem repeat polymorphism in exon 4 of esophageal cancer related gene 2 predicts relapse of oral squamous cell carcinoma.
17352218 Short tandem repeat polymorphisms of exon 4 in Kazal-type gene ECRG2 in pancreatic carcinoma and chronic pancreatitis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14639608 2004 Short tandem repeat polymorphism in a novel esophageal cancer-related gene (ECRG2) implicates susceptibility to esophageal cancer in Chinese population.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12970870 2003 Using yeast two-hybrid system to identify ECRG2 associated proteins and their possible interactions with ECRG2 gene.
12646258 2003 ECRG2, a novel candidate of tumor suppressor gene in the esophageal carcinoma, interacts directly with metallothionein 2A and links to apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.