Property Summary

NCBI Gene PubMed Count 182
PubMed Score 508.39
PubTator Score 1251.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Barrett's esophagus 3.800 2.0e-02
esophageal adenocarcinoma 5.100 1.8e-02
cutaneous lupus erythematosus -1.500 8.4e-03
psoriasis -3.800 1.5e-88
tuberculosis and treatment for 3 months -3.300 9.2e-08
non-small cell lung carcinoma 2.900 3.1e-14
intraductal papillary-mucinous neoplasm ... -2.000 1.7e-03
colon cancer -2.100 6.6e-03
active Crohn's disease 1.045 2.9e-03
interstitial cystitis -5.200 1.2e-06
cystic fibrosis 2.200 4.1e-04
lung adenocarcinoma 3.100 2.2e-04
spina bifida -2.121 3.5e-02
ulcerative colitis 1.500 1.9e-03

Gene RIF (203)

PMID Text
26743468 Approx 25% of discontinuously involved prostate biopsy cores showed tumor foci with discordant ERG/SPINK1 status, consistent with multiclonal disease.
26658045 Letter/Case Report: high penetrance of the PRSS1 A16V mutation caused by SPINK1 N34S and CFTR TG11-5T co-mutations associated with pancreatitis.
26632706 Patients with SPINK1 N34S mutations were more likely to develop a Dilated duct, Calcifications, and Diabetes as Long-term Outcome of Endoscopic Treatments in Idiopathic Chronic Pancreatitis.
26437224 expression represents an independent prognostic factor for poor survival in ovarian carcinoma patients
26376395 no mutation associated with pancreatitis
26348468 Identify SPINK1 promoter variants exhibiting significant functional defects that should be considered potential risk factors for chronic pancreatitis.
26172920 neither ERG nor SPINK1 appear to be useful biomarkers for prognostication of early stage prostate cancer
26124326 SPINK1 promoter variants are likely to be associated with the risk of BPH.
26100556 Mutation p.N34S in SPINK1 may predispose patients to acute pancreatitis, especially in those abusing alcohol, and may promote a more severe course of the disease.
26054682 Over-expression of FOXP1 and SPINK1 may participate in the carcinogenesis of hepatitis B virus related cirrhosis.
26037168 The SPINK1 protein seems to play a role in tumor proliferation.
25981744 The majority of children with genetic predisposition to idiopathic acute and acute recurrent pancreatitis have the SPINK1 mutation.
25862856 OPN, SPINK1, GPC3 and KNPA2 were significantly over-expressed in HCC tissues. These genes may be useful in developing future biomarkers and therapeutic strategies for HCC
25835118 This study shows that PRSS1, SPINK1 and CFTR mutations do not play a role in alcoholic and idiopathic chronic pancreatitis patients.
25804623 Evidence suggests that SPINK1 is an important growth factor that connects chronic inflammation and cancer.
25792561 Results suggest that sequence evaluation of the SPINK1 promoter region in patients with chronic pancreatitis is justified as part of the etiological investigation.
25667483 An association between strong claudin-5 expression and higher serum levels of TATI (p=0.04) and CA125 (p=0.008) were found
25639219 ERG and TFF3 expression characterize 2 distinct subsets of prostate cancer, with a more aggressive subgroup of TFF3-expressing tumors that express SPINK1.
25531719 These data highlight the importance of SPINK1/TATI as a tumor marker for HCV-induced HCC and may lead to a better understanding of HCV-induced hepatocarcinogenesis.
25383785 In Israel, pediatric as well as adult recurrent acute pancreatitis and chronic pancreatitis are often associated with cationic trypsinogen, SPINK1, chymotrypsin C, or Cystic Fibrosis Transmembrane Conductance Regulator mutations.
25206283 One novel SPINK1 mutation was identified in Mexican patients with early onset idiopathic recurrent acute pancreatitis.
25003218 The SPINK1 mutation frequency was significantly decreased in patients with pancreatic cancer in comparison with patients with idiopathic pancreatitis but varied not significantly in comparison with healthy controls.
24844923 The p.N34S mutation in SPINK1 gene was found more frequently in patients with AP in the Indian population, irrespective of disease etiology and whether the disease was recurrent or not, and with earlier age of onset.
24687926 Our results suggest that SPINK1 protein expression may not be a predictor of recurrence or lethal prostate cancer amongst men treated by radical prostatectomy
24654459 Studied TATI levels in a group of 305 patients suffering from carcinoma of the uterine body, who were primarily operated and then subjected to supplementary therapy.
24616641 study found a significant association of SPINK1 (N34S) gene polymorphism with chronic pancreatitis
24583226 Over-expression of TATI predicts an unfavorable outcome in several cancers and serum TATI can be used to identify patients at increased risk of aggressive disease--{REVIEW}
24254562 Our study suggests that TATI may be used to identify potentially high-risk groups of upper gastric carcinoma; elevated level of TATI was associated with progressive disease or advanced stage
24204699 Data indicate epidermal growth factor receptor (EGFR)+/tumor-associated trypsinogen inhibitor (TATI)+ patients showed better survival.
24134754 the p.N43S mutation in the SPINK1 gene, accelerated the onset of HP in the presence of the p.R122H mutation in the CT gene.
24075519 Cyst fluid SPINK1 may be a possible marker in the differential diagnosis of benign and potentially malignant cystic pancreatic lesions.
23951356 SPINK1 variants either caused or contributed to idiopathic chronic pancreatitis in 6.7% and 9.1% of cases respectively.
23843146 the data demonstrate that SPINK1 overexpression is tightly linked to the small subsets of 6q15- and 5q21-deleted ERG negative prostate cancers.
23751316 No association of SPINK1 with pancreatic cancer is found.
23527199 Global gene expression profiling reveals SPINK1 as a potential hepatocellular carcinoma marker.
23475261 SPINK1 plays a role as a growth factor, signaling through the EGFR pathway in pancreatic ductal adenocarcinoma and neoplasms, and that the EGFR is involved in the malignant transformation of IPMN.
23459095 ERG and TATI are not co-expressed in the same prostatic tumor cells.
23348902 Automated dual ERG-PTEN and ERG-SPINK1 immunohistochemisty assays are simple, reliable and portable across study sites for the simultaneous assessment of these proteins in prostate cancer.
23017645 The presence of the serine protease inhibitor Kazal type 1 c.194+2T>C mutation seems to be associated with idiopathic chronic pancreatitis and could predispose individuals to pancreatic diabetes onset at an earlier age.
22955423 molecular dynamics study to investigate effects of D50E and Y54H mutations on SPINK1 dynamics and conformation; found the structures of D50E and Y54H mutants were less stable than and were distorted from those of the wild type; unwinding of the top of helices and the distortion of the loops above the helices were observed
22944196 Data suggest that serine protease inhibitor Kazal type I (SPINK1) may serve as a biomarker for tumor staging and may be useful as an adjunct in clinical decision-making.
22751291 The N34S mutation of the SPINK1 gene seems to be significantly correlated with alcoholic chronic pancreatitis.
22699143 Data show that pediatric patients bearing the N34S G allele exhibited a 10-fold increased risk of developing acute pancreatitis (AP) compared with controls, suggesting that the SPINK1 N34S mutation represents an etiologic risk factor for AP.
22526274 Serum PSTI levels were decreased in patients with chronic pancreatitis or recurrent acute pancreatitis who have the IVS3+2T>C and p.P45S variants of the SPINK1 gene.
22508321 TATI may protect the tissue from destruction and thereby from tumour spread in colorectal cancer.
22427236 Frequencies of CFTR variants p.R75Q, p.I148T, 5T-allele and p.E528E were comparable in patients and controls. We identified 103 CFTR variants, which represents a 2.7-fold risk increase (p<0.0001).
22363992 N34S mutation plays a significant role in the development of chronic pancreatitis (CP) in the Russian population and can detect more than 10% of cases of idiopathic CP.
22343981 Letter: functionally analyzed 8 missense mutations in the SPINK1 gene.
22313860 Blood mRNA levels of prostate cancer genes may represent a novel aspect of monitoring prostate cancer and have implications for the understanding of tumour-derived mRNA
22307441 Prediction formulae based upon serum beta2-microglogulin/TATI may more reliably estimate glomerular filtration rate in heavy proteinuria.
22228370 The SPINK1 variant p.N34S is overrepresented in patients with acute pancreatitis
22094894 All of the heterozygote patients with a combination of CFTR and SPINK1 or PRSS1 mutations had chronic pancreatitis.
22042864 IFN regulatory factor 2 (Irf2) has a regulatory role in trypsinogen5 gene transcription, which is resistant to a major endogenous trypsin inhibitor, Spink3
22041280 The role of the SPINK1 is not just as a trypsin inhibitor, but also as a growth factor as well as a negative regulator of autophagy. (review)
21952138 No mutation was found in the SPINK1 gene in members of a Malaysian Chinese family with hereditary pancreatitis.
21864386 Tumor-Associated Trypsin Inhibitor has a role as a prognostic biomarkers in patients with rectal cancer, independent of neoadjuvant radiotherapy
21792085 Data shsow that alcoholic patients without coexisting high-risk PRSS1, CFTR, or SPINK1 variants had a significant overrepresentation of O blood type when compared with controls.
21739120 While there was no prognostic benefit to TATI when adjusted for standard clinicopathologic features of urothelial carcinoma of the bladder (UCB), it seems to play an important biologic role in UCB pathogenesis and invasion.
21656687 Immunohistochemistry showed that SPINK1 was absent in normal breast, present in early and advanced tumours, and its expression correlated with poor survival in estrogen receptor-positive tumours.
21610753 Only the three promoter variants associated with a loss-of-function (ie, -53C>T, -142T>C and -147A>G) are likely to be disease-predisposing alterations in chronic pancreatitis.
21415673 Mutations in the SPINK1 gene (and PRSS1 gene) are highly associated with the development of childhood acute recurrent pancreatitis or chronic pancreatitis in Korean children .
21375584 SPINK-1/N34S is likely a disease-modifying mutation in chronic pancreatitis.
21368222 Data demonstrate that SPINK1 partially mediates its neoplastic effects through interaction with the epidermal growth factor receptor and suggest that SPINK1 may be a therapeutic target in a subset of patients with prostate cancer.
21323990 review of its association with chronic pancreatitis in the Asia Pacific region
20977904 Coinheritance of the CFTR variant p.R75Q or CF causing CFTR variants with SPINK1 variants significantly increases the risk of chronic pancreatitis.
20977904 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20849596 Increased serum levels of tumour-associated trypsin inhibitor is associated with colorectal cancer.
20676769 The frequency of the SPINK1 N34S mutation in patients with idiopathic chronic pancreatitis was similar to that in many earlier studies but was higher in Polish patients with alcoholic chronic pancreatitis.
20676769 Observational study of gene-disease association. (HuGE Navigator)
20625975 Observational study of gene-disease association. (HuGE Navigator)
20551465 Strong genetic susceptibility due to SPINK1 and CFTR gene mutations, and comparative phenotype of idiopathic CP in India suggest that the term 'tropical calcific pancreatitis' is a misnomer.
20551465 Observational study of gene-disease association. (HuGE Navigator)
20543535 Phenotypic variability of the homozygous IVS3+2T>C mutation in the SPINK1 gene in patients with chronic pancreatitis is reported.
20502448 In Denmark, the occurrence of exocrine and endocrine insufficiency is higher among patients with HP than in patients with SPINK1-CFTR mutations and tIP, and more HP families develop pancreatic cancer.
20502448 Observational study of gene-disease association. (HuGE Navigator)
20442300 expression, found in approximately 10% of prostate cancers, was associated with aggressive form of the disease and could serve as a biomarker in endocrine-treated prostate cancer.
20108119 Observational study of gene-disease association. (HuGE Navigator)
19888199 SPINK1 N34S polymorphism substantially increases the risk of recurrent acute pancreatitis.
19888199 Observational study of gene-disease association. (HuGE Navigator)
19864383 Upregulation of SPIK caused by HBV and HCV replication leads to cell resistance to apoptosis.
19845895 Observational study of gene-disease association. (HuGE Navigator)
19844201 We did not find a statistically significant association of ARP or CP with the N34S SPINK-1 gene mutation.
19844201 Observational study of gene-disease association. (HuGE Navigator)
19696993 A strong association of N34S mutation in the serine protease inhibitor, Kazal type1 (SPINK1) gene1 with TCP has been observed.
19657220 A total of 5.8% of chronic pancreatitis patients were identified with the N34S mutation in SPINK1.
19657220 Observational study of gene-disease association. (HuGE Navigator)
19654461 Mutation of this gene is related to idiopathic chronic pancreatitis in youths and familial pancreatitis.
19593166 Patients with pancreas divisum presenting with idiopathic pancreatitis had a higher frequency of SPINK1 gene mutation compared with healthy controls.
19593166 Observational study of gene-disease association. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19565042 The SPINK1 N34S mutation is a weak risk factor for alcoholic chronic pancreatitis.
19565042 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19502653 Observational study of gene-disease association. (HuGE Navigator)
19465903 SPINK1, a biomarker expressed exclusively in a subset of ETS negative prostate carcinomas, was expressed in 6% of ETS negative histologic variants, specifically in ductal adenocarcinoma.
19433603 The mutation spectrum of PRSS1 and SPNK1 genes in chinese subjects is different from that in western countries.
19433603 Observational study of gene-disease association. (HuGE Navigator)
19404200 SPINK1 p.N34S was present in 31.8% of patients compared with 4.7% in controls, there was no significant cosegregation with chymotrypsinogen C (CTRC) variants.
19404200 Observational study of gene-disease association. (HuGE Navigator)
19384300 High TATI expression is associated with liver metastasis and is an independent predictor of poor prognosis in patients with colorectal cancer.
19372376 Includes the study of a disease-related upstream ORF in this gene, and shows that it functions to reduce protein levels by 100%.
19147803 PSTI is a major bioactive peptide present in human milk that can influence restitution, apoptosis, gut mucosal protection and repair.
19096130 Observational study of gene-disease association. (HuGE Navigator)
19077465 N34S SPINK1 represents the major genetic risk factor in tropical calcific pancreatitis.
19077465 Observational study of gene-disease association. (HuGE Navigator)
18986377 Observational study of gene-disease association. (HuGE Navigator)
18978175 The marked negative impact of the c.194+2T>C variant on SPINK1 expression supports the notion that SPINK1 variants increase the risk of chronic pancreatitis by diminishing protective trypsin inhibitor levels.
18953248 Observational study of gene-disease association. (HuGE Navigator)
18852684 PRSS1 and SPINK1 mutations were not rare in Korean patients with idiopathic and familial pancreatitis. SPINK1 IVS3+2T>C was a prevalent mutation in this population.
18706099 co-existence of TCF7L2 variants and the SPINK1 and CTSB mutations, that predict susceptibility to exocrine damage, may interact to determine the onset of diabetes in TCP patients
18706099 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18680227 There was no association between the various CASR genotypes and SPINK1 N34S in pancreatitis.
18680227 Observational study of gene-disease association. (HuGE Navigator)
18617776 The SPINK1 N34S variant is associated with acute pancreatitis. This supports the importance of premature protease activation in the pathogenesis of AP and suggests that mutated SPINK1 may predispose certain individuals to develop this disease.
18617776 Observational study of gene-disease association. (HuGE Navigator)
18580441 Benign pancreatic hyperenzymemia cannot be explained by mutations in SPINK1.
18580441 Observational study of gene-disease association. (HuGE Navigator)
18538735 Suggest functional role for SPINK1 in ETS rearrangement-negative prostate cancers.
18428024 Total immunoreactivity of soluble urinary MMP-14 and the levels of trypsin (TRY)-1 and TRY-2, but not of TATI, were also significantly increased in diabetic nephropathy
18414673 the SPINK1 N34S haplotype may have a role in chronic pancreatitis
18414673 Meta-analysis of gene-disease association. (HuGE Navigator)
18347987 over-expression of cellular protein called serine protease inhibitor Kazal (SPIK) results in significant decrease in cell susceptibility to serine protease dependent cell apoptosis, suggesting that SPIK is an apoptosis inhibitor suppressing this pathway.
18336671 Variants of this alcohol-metabolizing enzyme appeared in the relation to alcoholic chronic pancreatitis
18336671 Observational study of gene-disease association. (HuGE Navigator)
18317448 TATI as an autocrine transforming factor potentially involved in early and late events of colon cancer progression, including local invasion of the primary tumor and its metastatic spread.
18182741 the SPINK1 gene is a susceptibility locus for alcoholic pancreatitis
18076731 pancreatitis seems associated with genetic risk factors such as mutations in the SPINK1
18076731 Observational study of gene-disease association. (HuGE Navigator)
17990360 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17990360 Polymorphisms in reg1alpha gene, including the regulatory variants singly or in combination with the known mutations in SPINK1 and/or CTSB genes, are not associated with tropical calcific pancreatitis.
17981921 Observational study of gene-disease association. (HuGE Navigator)
17681820 Co-inheritance of a novel deletion of the entire SPINK1 gene with a CFTR missense mutation (L997F) is associated with chronic pancreatitis
17613931 in the investigated Finnish pedigree with hereditary pancreatitis, the PRSS1 mutation R122H is linked with chronic disease; although the SPINK1 mutation (N34S) was also observed in two individuals, it was not linked with the disease
17568390 analysis of seven missense mutations which probably cause intracellular retention of the respective mutant proteins
17525091 The results identify intracellular folding defects as a novel mechanism of SPINK1 deficiency associated with chronic pancreatitis.
17489851 Observational study of gene-disease association. (HuGE Navigator)
17489851 mutations/variants of SPINK1 gene with or without cystic fibrosis transmembrane conductance regulator gene may confer a high risk for recurrent pancreatitis
17446841 splicing mutation might represent a mechanism for SPINK1-associated chronic pancreatitis, but the N34S mutation is not associated with alternative splicing
17333166 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17238043 Observational study of gene-disease association. (HuGE Navigator)
17238043 SPINK1 mutations were associated with idiopathic and familial chronic pancreatitis, whereas the contribution was less evident in alcoholic chronic pancreatitis
17163998 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17072959 Observational study of gene-disease association. (HuGE Navigator)
17003641 Observational study of genotype prevalence. (HuGE Navigator)
17003641 Mutations and variations in pancreatitis patients.
16981266 Observational study of gene-disease association. (HuGE Navigator)
16981266 SPINK1 gene mutation is associated with another base substitution in chronic pancreatitis patients
16958672 Observational study of gene-disease association. (HuGE Navigator)
16958672 in Japan the [-215G > A; IVS3 + 2T > C] mutation in the SPINK1 gene may form a unique genetic background for pancreatitis
16954950 Observational study of gene-disease association. (HuGE Navigator)
16954950 protease serine 1 protease(PRSS1) defects seem to be causative for pancreatitis, whereas defects in protease serine 1 protease(SPINK1) are suggested to be associated with the disease
16764792 Mutations in the gene encoding cationic trypsinogen have recently been identified to be associated with hereditary pancreatitis.
16497624 only the patient with the combination of both CASR and N34S SPINK1 gene mutation developed pancreatitis, whereas in the healthy parents and children only an isolated CASR or N34S SPINK1 gene mutation could be detected.
16327984 study suggests a balanced expression of TATI and trypsinogen is required in normal tissue and that this balance is disrupted during tumor progression
16187186 Observational study of gene-disease association. (HuGE Navigator)
15987793 Observational study of gene-disease association. (HuGE Navigator)
15980664 Observational study of gene-disease association. (HuGE Navigator)
15910626 Observational study of gene-disease association. (HuGE Navigator)
15810949 High TATI expression in tumour tissue was detected more frequently in patients with early-stage gastric cancer and seems to correlate with a favourable outcome.
15782101 Observational study of gene-disease association. (HuGE Navigator)
15782101 SPINK1 N34S mutation enhances the susceptibility of acute pancreatitis
15764155 Observational study of gene-disease association. (HuGE Navigator)
15764155 The SPINK1 N34S mutation was significantly associated with an increased risk of chronic pancreatits.
15753612 The SPINK1-N34S mutation is not associated with chronic parotitis.
15749233 pivotal roles of CFTR and PSTI during pancreatic exocrine secretion
15749232 in most patients with SPINKI-associated chronic pancreatitis, this genetic variant acts as disease modifier or within a polygenic model with other yet unidentified genes or environmental co-factors
15367892 An A to G transition resulting in a substitution of asparagine by serine at codon 34 in exon3 (N34S) of PSTI was associated with acute pancreatitis in a pregnant patient & her father. Her sister showed an intronic sequence variant PSTI, 272 C>T in 3'UTR.
15329520 Observational study of gene-disease association. (HuGE Navigator)
15238770 Observational study of gene-disease association. (HuGE Navigator)
15082592 Observational study of gene-disease association. (HuGE Navigator)
14722925 A novel heterozygous splicing mutation and a novel heterozygous microdeletion in the SPINK1 gene in hereditary pancreatitis patients.
14688470 Observational study of gene-disease association. (HuGE Navigator)
14688470 Polymorphisms in SPINK1 are associated with an increased risk of developing pancreatitis but are not a risk for developing pancreatic neoplasms.
14675563 In gastrointestinal cancer, TATI can be used as a complementary tumour marker in addition to CEA. Regulation of TATI synthesis resembles that of acute-phase reactant proteins
14595541 Mutation not associated with type1 or type 2 diabetes in India and Germany.
14526128 Observational study of gene-disease association. (HuGE Navigator)
14526128 The 253C allele for the SPINK1 gene was significantly more frequent in Brazilian pancreatitis patients than controls.
12973686 in colorectal neoplasms, high levels of trypsin and TATI may be important for malignant tumour formation and/or metastatic process
12939655 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
12875970 Results identify two genes, the 67-kd laminin receptor (67LR) and tumor-associated trypsin inhibitor (TATI), that may be involved in the early phases of urothelial tumor development rather than with disease progression.
12825076 Observational study of gene-disease association. (HuGE Navigator)
12825076 Association of SPINK1 with cystic fibrosis transmembrane conductance regulator (CFTR) gene mutations in pancreatitis patients is statistically significant.
12822871 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12649567 Observational study of gene-disease association. (HuGE Navigator)
12649567 The N34S mutation of SPINK1 appears not to be a distinct genetic risk factor in patients with sporadic pancreatic cancer.
12529713 No difference was observed in the frequency of PRSS1 or PSTI polymorphisms in neonates carrying or not carrying CF mutations.
12452372 Observational study of gene-disease association. (HuGE Navigator)
12360464 Observational study of gene-disease association. (HuGE Navigator)
12360464 SPINK1/PSTI mutations are associated with tropical pancreatitis and type II diabetes mellitus in Bangladesh.
12360463 Observational study of gene-disease association. (HuGE Navigator)
12360463 Tropical calcific pancreatitis: strong association with SPINK1 trypsin inhibitor mutations.
12187509 Observational study of gene-disease association. (HuGE Navigator)
12187509 the N34S variant of SPINK1 is a susceptibility gene for FCPD in the Indian subcontinent, although, by itself, it is not sufficient to cause disease.
12120224 mutations have a possible role in idiopathic chronic pancreatitis, familial pancreatitis, hereditary pancreatitis and tropical pancreatitis
12120220 Observational study of gene-disease association. (HuGE Navigator)
12014716 Observational study of gene-disease association. (HuGE Navigator)
12014716 Point mutation in patients with idiopathic chronic pancreatitis. frequency of the N34S SPINKI gene mutation. N34S mutation in the SPINKI gene is strongly associated with ICP, especially with the early-onset type.
12011155 Mutations in the pancreatic secretory trypsin inhibitor gene are significantly associated with tropical calcific pancreatitis
11950817 Observational study of gene-disease association. (HuGE Navigator)
11950817 Identification of SPINK1 mutations patients with adult alcoholic and idiopathic chronic pancreatitis suggests an important role for SPINK1 as a predisposing factor in adult chronic pancreatitis.
11950815 Observational study of gene-disease association. (HuGE Navigator)
11950815 Mutations in the PRSS1 gene explain most occurrences of hereditary pancreatitis (HP) but many HP families have no PRSS1 mutation.
11938439 Observational study of gene-disease association. (HuGE Navigator)
11866271 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTS      1 - 70
ILIQKSGPC                                                                  71 - 79
//

Text Mined References (183)

PMID Year Title
26743468 2016 Clonal evaluation of prostate cancer foci in biopsies with discontinuous tumor involvement by dual ERG/SPINK1 immunohistochemistry.
26658045 2016 High Penetrance of the PRSS1 A16V Mutation in a Kindred With SPINK1 N34S and CFTR TG11-5T Co-mutations.
26632706 2015 Serine Protease Inhibitor Kazal Type 1 (SPINK1) c.194+2T > C Mutation May Predict Long-term Outcome of Endoscopic Treatments in Idiopathic Chronic Pancreatitis.
26437224 2015 Serine protease inhibitor Kazal type 1 (SPINK1) drives proliferation and anoikis resistance in a subset of ovarian cancers.
26376395 2015 Hereditary Pancreatitis Associated With the N29T Mutation of the PRSS1 Gene in a Brazilian Family: A Case-Control Study.
26348468 2016 SPINK1 Promoter Variants in Chronic Pancreatitis.
26172920 2015 Evaluation of ERG and SPINK1 by Immunohistochemical Staining and Clinicopathological Outcomes in a Multi-Institutional Radical Prostatectomy Cohort of 1067 Patients.
26124326 2015 SPINK1 Promoter Variants Are Associated with Prostate Cancer Predisposing Alterations in Benign Prostatic Hyperplasia Patients.
26100556 2015 Genetic mutations in SPINK1, CFTR, CTRC genes in acute pancreatitis.
26054682 2015 FOXP1 and SPINK1 reflect the risk of cirrhosis progression to HCC with HBV infection.
26037168 2015 Serine Protease Inhibitor Kazal Type 1 (SPINK1) Promotes Proliferation of Colorectal Cancer Through the Epidermal Growth Factor as a Prognostic Marker.
25981744 2015 Genetic predisposition and its impact on natural history of idiopathic acute and acute recurrent pancreatitis in children.
25862856 2015 Gene expression analysis for evaluation of potential biomarkers in hepatocellular carcinoma.
25835118 2015 Mutation analysis of PRSS1, SPINK1 and CFTR gene in patients with alcoholic and idiopathic chronic pancreatitis: A single center study.
25804623 2015 SPINK1 Status in Colorectal Cancer, Impact on Proliferation, and Role in Colitis-Associated Cancer.
25792561 2015 Functional significance of SPINK1 promoter variants in chronic pancreatitis.
25667483 2015 Claudin-5 is associated with elevated TATI and CA125 levels in mucinous ovarian borderline tumors.
25639219 2015 Clinical value of ERG, TFF3, and SPINK1 for molecular subtyping of prostate cancer.
25531719 2014 Overexpression of tumor-associated trypsin inhibitor (SPINK1/TATI) in hepatitis C-associated hepatocellular carcinoma: potential implications for viral hepatocarcinogenesis.
25383785 2015 Genetic and electrophysiological characteristics of recurrent acute pancreatitis.
25206283 2014 PRSS1 and SPINK1 mutations in idiopathic chronic and recurrent acute pancreatitis.
25003218 2014 CFTR, SPINK1, PRSS1, and CTRC mutations are not associated with pancreatic cancer in German patients.
24844923 2014 Frequency of SPINK1?N34S mutation in acute and recurrent acute pancreatitis.
24687926 2014 SPINK1 protein expression and prostate cancer progression.
24654459 2014 Assessment of the tumor-associated trypsin inhibitor (TATI) marker in patients with carcinoma of the uterine body 17 years after treatment.
24616641 2014 Frequency of CFTR, SPINK1, and cathepsin B gene mutation in North Indian population: connections between genetics and clinical data.
24583226 2014 TATI as a biomarker.
24254562 2013 The relationship between serum tumor-associated trypsin inhibitor levels and clinicopathological parameters in patients with gastric cancer.
24204699 2013 Concomitant tumor expression of EGFR and TATI/SPINK1 associates with better prognosis in colorectal cancer.
24134754 2013 Childhood-onset hereditary pancreatitis with mutations in the CT gene and SPINK1 gene.
24075519 Cyst fluid SPINK1 may help to differentiate benign and potentially malignant cystic pancreatic lesions.
23951356 2013 A conservative assessment of the major genetic causes of idiopathic chronic pancreatitis: data from a comprehensive analysis of PRSS1, SPINK1, CTRC and CFTR genes in 253 young French patients.
23843146 2013 SPINK1 expression is tightly linked to 6q15- and 5q21-deleted ERG-fusion negative prostate cancers but unrelated to PSA recurrence.
23751316 2013 Clinical and morphological characteristics of sporadic genetically determined pancreatitis as compared to idiopathic pancreatitis: higher risk of pancreatic cancer in CFTR variants.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23527199 2013 Global gene expression profiling reveals SPINK1 as a potential hepatocellular carcinoma marker.
23475261 2013 Serine protease inhibitor Kazal type 1 and epidermal growth factor receptor are expressed in pancreatic tubular adenocarcinoma, intraductal papillary mucinous neoplasm, and pancreatic intraepithelial neoplasia.
23459095 2013 A high-density tissue microarray from patients with clinically localized prostate cancer reveals ERG and TATI exclusivity in tumor cells.
23348902 2013 Novel dual-color immunohistochemical methods for detecting ERG-PTEN and ERG-SPINK1 status in prostate carcinoma.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23017645 2013 The contribution of the SPINK1 c.194+2T>C mutation to the clinical course of idiopathic chronic pancreatitis in Chinese patients.
22955423 2013 Molecular dynamics simulations reveal structural instability of human trypsin inhibitor upon D50E and Y54H mutations.
22944196 2013 Loss of SPINK1 expression is associated with unfavorable outcomes in urothelial carcinoma of the bladder after radical cystectomy.
22751291 2012 The N34S mutation of the SPINK1 gene and alcoholic chronic pancreatitis.
22699143 2012 Screening of R122H and N29I mutations in the PRSS1 gene and N34S mutation in the SPINK1 gene in Mexican pediatric patients with acute and recurrent pancreatitis.
22526274 2012 Do genetic variants in the SPINK1 gene affect the level of serum PSTI?
22508321 2012 Tumour-associated trypsin inhibitor TATI is a prognostic marker in colorectal cancer.
22427236 2013 CFTR, SPINK1, CTRC and PRSS1 variants in chronic pancreatitis: is the role of mutated CFTR overestimated?
22363992 2011 [Pancreatic secretory trypsin inhibitor gene N34S mutation in patients with idiopathic chronic pancreatitis].
22343981 2012 Functional analysis of eight missense mutations in the SPINK1 gene.
22313860 2012 Phase II study of cytarabine in men with docetaxel-refractory, castration-resistant prostate cancer with evaluation of TMPRSS2-ERG and SPINK1 as serum biomarkers.
22307441 Creatinine clearance, cystatin C, beta2-microglobulin and TATI as markers of renal function in patients with proteinuria.
22228370 2012 Is the SPINK1 variant p.N34S overrepresented in patients with acute pancreatitis?
22094894 2012 Genetic prevalence and characteristics in children with recurrent pancreatitis.
22042864 2011 Characterization of dsRNA-induced pancreatitis model reveals the regulatory role of IFN regulatory factor 2 (Irf2) in trypsinogen5 gene transcription.
22041280 2011 Roles of serine protease inhibitor Kazal type 1 (SPINK1) in pancreatic diseases.
21952138 2011 Interaction between a novel intronic IVS3+172 variant and N29I mutation in PRSS1 gene is associated with pancreatitis in a Malaysian Chinese family.
21864386 2011 Effects of radiation therapy on tissue and serum concentrations of tumour associated trypsin inhibitor and their prognostic significance in rectal cancer patients.
21792085 2011 ABO blood group and chronic pancreatitis risk in the NAPS2 cohort.
21739120 2012 Association of tumor-associated trypsin inhibitor (TATI) expression with molecular markers, pathologic features and clinical outcomes of urothelial carcinoma of the urinary bladder.
21656687 2011 Combined genomic and phenotype screening reveals secretory factor SPINK1 as an invasion and survival factor associated with patient prognosis in breast cancer.
21610753 2011 Assessing the pathological relevance of SPINK1 promoter variants.
21415673 2011 High incidence of PRSS1 and SPINK1 mutations in Korean children with acute recurrent and chronic pancreatitis.
21375584 2011 Presence of SPINK-1 variant alters the course of chronic pancreatitis.
21368222 2011 Therapeutic targeting of SPINK1-positive prostate cancer.
21323990 2011 Genetic basis of chronic pancreatitis in Asia Pacific region.
20977904 2011 Combined bicarbonate conductance-impairing variants in CFTR and SPINK1 variants are associated with chronic pancreatitis in patients without cystic fibrosis.
20849596 2010 Increased serum levels of tumour-associated trypsin inhibitor independently predict a poor prognosis in colorectal cancer patients.
20676769 2011 The prevalence of cationic trypsinogen (PRSS1) and serine protease inhibitor, Kazal type 1 (SPINK1) gene mutations in Polish patients with alcoholic and idiopathic chronic pancreatitis.
20625975 2011 Multifactorial genesis of pancreatitis in primary hyperparathyroidism: evidence for "protective" (PRSS2) and "destructive" (CTRC) genetic factors.
20551465 2010 Idiopathic chronic pancreatitis in India: phenotypic characterisation and strong genetic susceptibility due to SPINK1 and CFTR gene mutations.
20543535 2010 Phenotypic variability of the homozygous IVS3+2T>C mutation in the serine protease inhibitor Kazal type 1 (SPINK1) gene in patients with chronic pancreatitis.
20502448 2010 Genetic, epidemiological, and clinical aspects of hereditary pancreatitis: a population-based cohort study in Denmark.
20442300 2010 Association of SPINK1 expression and TMPRSS2:ERG fusion with prognosis in endocrine-treated prostate cancer.
20108119 2010 Incidence, prevalence, etiology, and prognosis of first-time chronic pancreatitis in young patients: a nationwide cohort study.
19888199 2010 SPINK1 N34S is strongly associated with recurrent acute pancreatitis but is not a risk factor for the first or sentinel acute pancreatitis event.
19864383 2010 Hepatitis B and hepatitis C virus replication upregulates serine protease inhibitor Kazal, resulting in cellular resistance to serine protease-dependent apoptosis.
19845895 2009 Fine mapping of the CELIAC2 locus on chromosome 5q31-q33 in the Finnish and Hungarian populations.
19844201 2010 Connections between genetics and clinical data: Role of MCP-1, CFTR, and SPINK-1 in the setting of acute, acute recurrent, and chronic pancreatitis.
19696993 Genotype-phenotype correlation in 9 patients with tropical pancreatitis and identified gene mutations.
19657220 2009 Genetic mutations in a Spanish population with chronic pancreatitis.
19654461 2009 [Pancreatitis-associated genes and development of pancreatic cancer].
19593166 2009 Association of SPINK1 gene mutation and CFTR gene polymorphisms in patients with pancreas divisum presenting with idiopathic pancreatitis.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19565042 2009 Investigation of the SPINK1 N34S mutation in Romanian patients with alcoholic chronic pancreatitis. A clinical analysis based on the criteria of the M-ANNHEIM classification.
19502653 Common SPINK-1 mutations do not predispose to the development of non-alcoholic fatty liver disease.
19465903 2009 Characterization of ETS gene aberrations in select histologic variants of prostate carcinoma.
19433603 2009 Association and differential role of PRSS1 and SPINK1 mutation in early-onset and late-onset idiopathic chronic pancreatitis in Chinese subjects.
19404200 2009 Tropical calcific pancreatitis and its association with CTRC and SPINK1 (p.N34S) variants.
19384300 2009 High expression of tumour-associated trypsin inhibitor correlates with liver metastasis and poor prognosis in colorectal cancer.
19372376 2009 Upstream open reading frames cause widespread reduction of protein expression and are polymorphic among humans.
19147803 2009 Pancreatic secretory trypsin inhibitor is a major motogenic and protective factor in human breast milk.
19096130 2008 Microsatellite scan identifies new candidate genes for susceptibility to alcoholic chronic pancreatitis in Japanese patients.
19077465 2009 Divergent roles of SPINK1 and PRSS2 variants in tropical calcific pancreatitis.
18986377 2010 Association analyses of genetic polymorphisms of GSTM1, GSTT1, NQO1, NAT2, LPL, PRSS1, PSTI, and CFTR with chronic alcoholic pancreatitis in Japan.
18978175 2009 Minigene analysis of intronic variants in common SPINK1 haplotypes associated with chronic pancreatitis.
18953248 2008 Clinical and radiological outcome of patients suffering from chronic pancreatitis associated with gene mutations.
18852684 2009 Analysis of PRSS1 and SPINK1 mutations in Korean patients with idiopathic and familial pancreatitis.
18706099 2008 TCF7L2 gene polymorphisms do not predict susceptibility to diabetes in tropical calcific pancreatitis but may interact with SPINK1 and CTSB mutations in predicting diabetes.
18680227 2008 Association between calcium sensing receptor gene polymorphisms and chronic pancreatitis in a US population: role of serine protease inhibitor Kazal 1type and alcohol.
18617776 2008 The SPINK1 N34S variant is associated with acute pancreatitis.
18580441 2008 SPINK1 and PRSS1 mutations in benign pancreatic hyperenzymemia.
18538735 2008 The role of SPINK1 in ETS rearrangement-negative prostate cancers.
18428024 2008 Urinary matrix metalloproteinase -8, -9, -14 and their regulators (TRY-1, TRY-2, TATI) in patients with diabetic nephropathy.
18414673 2008 Pathways to injury in chronic pancreatitis: decoding the role of the high-risk SPINK1 N34S haplotype using meta-analysis.
18347987 2008 Tumor-associated protein SPIK/TATI suppresses serine protease dependent cell apoptosis.
18336671 2008 SPINK1, ADH2, and ALDH2 gene variants and alcoholic chronic pancreatitis in Japan.
18317448 2008 Autocrine induction of invasion and metastasis by tumor-associated trypsin inhibitor in human colon cancer cells.
18182741 2008 A novel SPINK1 gene mutation, c.206C>T, in a Thai patient with chronic alcoholic pancreatitis.
18076731 2008 Pancreatitis risk in primary hyperparathyroidism: relation to mutations in the SPINK1 trypsin inhibitor (N34S) and the cystic fibrosis gene.
17990360 2007 Comprehensive screening for reg1alpha gene rules out association with tropical calcific pancreatitis.
17981921 2008 Association of cystic fibrosis transmembrane conductance regulator (CFTR) mutation/variant/haplotype and tumor necrosis factor (TNF) promoter polymorphism in hyperlipidemic pancreatitis.
17681820 Co-inheritance of a novel deletion of the entire SPINK1 gene with a CFTR missense mutation (L997F) in a family with chronic pancreatitis.
17613931 2007 Screening for human cationic trypsinogen (PRSS1) and trypsinogen inhibitor gene (SPINK1) mutations in a Finnish family with hereditary pancreatitis.
17568390 2007 Functional analysis of pancreatitis-associated missense mutations in the pancreatic secretory trypsin inhibitor (SPINK1) gene.
17525091 2007 Missense mutations in pancreatic secretory trypsin inhibitor (SPINK1) cause intracellular retention and degradation.
17489851 2007 Contribution of the CFTR gene, the pancreatic secretory trypsin inhibitor gene (SPINK1) and the cationic trypsinogen gene (PRSS1) to the etiology of recurrent pancreatitis.
17446841 2007 N34S mutation in the SPINK1 gene is not associated with alternative splicing.
17333166 2007 The SPINK gene family and celiac disease susceptibility.
17238043 2007 Differential roles of the SPINK1 gene mutations in alcoholic and nonalcoholic chronic pancreatitis.
17163998 2006 Lack of significant association of an insertion/deletion polymorphism in the angiotensin converting enzyme (ACE) gene with tropical calcific pancreatitis.
17072959 2006 Lack of association between UGT1A7, UGT1A9, ARP, SPINK1 and CFTR gene polymorphisms and pancreatic cancer in Italian patients.
17003641 2006 Identification of CFTR, PRSS1, and SPINK1 mutations in 381 patients with pancreatitis.
16981266 2006 Association of rare SPINK1 gene mutation with another base substitution in chronic pancreatitis patients.
16958672 2006 SPINK1 gene mutations and pancreatitis in Japan.
16954950 2006 Analysis of CFTR, SPINK1, PRSS1 and AAT mutations in children with acute or chronic pancreatitis.
16764792 2006 Genetic issues in pediatric pancreatitis.
16497624 2006 Mutations in the calcium-sensing receptor: a new genetic risk factor for chronic pancreatitis?
16327984 2006 Differential expression of trypsinogen and tumor-associated trypsin inhibitor (TATI) in bladder cancer.
16187186 2005 Mutation analysis of SPINK1 and CFTR gene in Korean patients with alcoholic chronic pancreatitis.
15987793 2005 Complete cystic fibrosis transmembrane conductance regulator gene sequencing in patients with idiopathic chronic pancreatitis and controls.
15980664 2005 Mutations in the serine protease inhibitor Kazal Type 1 (SPINK1) gene in Japanese patients with pancreatitis.
15910626 2005 The SPINK1 N34S mutation is not associated with Type 2 diabetes mellitus in a population of the USA.
15810949 2005 High tissue expression of tumour-associated trypsin inhibitor (TATI) associates with a more favourable prognosis in gastric cancer.
15782101 2005 Pancreatic secretory trypsin inhibitor (SPINK1) gene mutations in patients with acute pancreatitis.
15764155 2005 Mutations N34S and P55S of the SPINK1 gene in patients with chronic pancreatitis or pancreatic cancer and in healthy subjects: a report from Finland.
15753612 2004 Chronic parotitis: not another SPINKosis.
15749233 2005 The impact of cystic fibrosis and PSTI/SPINK1 gene mutations on susceptibility to chronic pancreatitis.
15749232 2005 Serine protease inhibitor kazal type 1 mutations and pancreatitis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15367892 2004 Acute pancreatitis in the early stages of pregnancy associated with a PSTI gene mutation.
15329520 2004 [Mutations of SPINK1 and PRSS1 gene in Korean patients with chronic pancreatitis].
15238770 2004 The role of CFTR and SPINK-1 mutations in pancreatic disorders in HIV-positive patients: a case-control study.
15082592 2004 Absence of PRSS1 mutations and association of SPINK1 trypsin inhibitor mutations in hereditary and non-hereditary chronic pancreatitis.
14722925 2004 Two novel severe mutations in the pancreatic secretory trypsin inhibitor gene (SPINK1) cause familial and/or hereditary pancreatitis.
14688470 Polymorphisms of SPINK1 N34S and CFTR in patients with sporadic and familial pancreatic cancer.
14675563 2004 Tumour-associated trypsin inhibitor, carcinoembryonic antigen and acute-phase reactant proteins CRP and alpha1-antitrypsin in patients with gastrointestinal malignancies.
14595541 2003 Absence of association between SPINK1 trypsin inhibitor mutations and Type 1 or 2 diabetes mellitus in India and Germany.
14526128 2003 CFTR, PRSS1 and SPINK1 mutations in the development of pancreatitis in Brazilian patients.
14507909 2003 Human mesotrypsin is a unique digestive protease specialized for the degradation of trypsin inhibitors.
12974284 2003 Gene symbol: Spink1-Omim 167790. Disease: Hereditary pancreatitis.
12973686 2003 Co-expression of trypsin and tumour-associated trypsin inhibitor (TATI) in colorectal adenocarcinomas.
12939655 2003 Mutation analysis of the cystic fibrosis transmembrane conductance regulator (CFTR) gene, the cationic trypsinogen (PRSS1) gene, and the serine protease inhibitor, Kazal type 1 (SPINK1) gene in patients with alcoholic chronic pancreatitis.
12875970 2003 Identification of genes up-regulated in urothelial tumors: the 67-kd laminin receptor and tumor-associated trypsin inhibitor.
12825076 2003 Mutations in the SPINK1 gene in idiopathic pancreatitis Italian patients.
12822871 2003 Limited contribution of the SPINK1 N34S mutation to the risk and severity of alcoholic chronic pancreatitis: a report from the United States.
12649567 2003 N34S, a pancreatitis associated SPINK1 mutation, is not associated with sporadic pancreatic cancer.
12529713 2003 Cationic trypsinogen and pancreatic secretory trypsin inhibitor gene mutations in neonatal hypertrypsinaemia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12452372 2002 Germline mutations in CFTR and PSTI genes in chronic pancreatitis patients.
12360464 2002 SPINK1/PSTI mutations are associated with tropical pancreatitis and type II diabetes mellitus in Bangladesh.
12360463 2002 Tropical calcific pancreatitis: strong association with SPINK1 trypsin inhibitor mutations.
12187509 2002 SPINK1 is a susceptibility gene for fibrocalculous pancreatic diabetes in subjects from the Indian subcontinent.
12120220 2001 Gene mutations in children with chronic pancreatitis.
12014716 2002 Mutations of the serine protease inhibitor, Kazal type 1 gene, in patients with idiopathic chronic pancreatitis.
12011155 2002 Mutations in the pancreatic secretory trypsin inhibitor gene (PSTI/SPINK1) rather than the cationic trypsinogen gene (PRSS1) are significantly associated with tropical calcific pancreatitis.
11938439 2002 Determination of the relative contribution of three genes-the cystic fibrosis transmembrane conductance regulator gene, the cationic trypsinogen gene, and the pancreatic secretory trypsin inhibitor gene-to the etiology of idiopathic chronic pancreatitis.
11866271 2002 Mutational screening of patients with nonalcoholic chronic pancreatitis: identification of further trypsinogen variants.
11355022 2001 Analysis of the human pancreatic secretory trypsin inhibitor (PSTI) gene mutations in Japanese patients with chronic pancreatitis.
10982753 2000 SPINK1/PSTI polymorphisms act as disease modifiers in familial and idiopathic chronic pancreatitis.
10835640 2000 Mutations in the gene encoding the serine protease inhibitor, Kazal type 1 are associated with chronic pancreatitis.
10691414 2000 Mutational analysis of the human pancreatic secretory trypsin inhibitor (PSTI) gene in hereditary and sporadic chronic pancreatitis.
9643675 1998 Human pancreatic secretory trypsin inhibitor. Distribution, actions and possible role in mucosal integrity and repair.
9452083 1998 Mutation in the 5' noncoding region of the SRY gene in an XY sex-reversed patient.
8433367 1993 Solution structure of a variant of human pancreatic secretory trypsin inhibitor determined by nuclear magnetic resonance spectroscopy.
7142173 1982 Purification and characterization of a tumor-associated trypsin inhibitor from the urine of a patient with ovarian cancer.
3877508 1985 Molecular cloning and nucleotide sequence of human pancreatic secretory trypsin inhibitor (PSTI) cDNA.
3501289 1987 Primary structure of human pancreatic secretory trypsin inhibitor (PSTI) gene.
2961612 1987 Expression of pancreatic secretory trypsin inhibitor gene in neoplastic tissues.
2110056 1990 A low-molecular-mass Kazal-type protease inhibitor isolated from rat hepatocytes is identical to rat pancreatic secretory trypsin inhibitor II. Purification and amino acid sequence.
2093478 1990 Interactions of pancreatic secretory trypsin inhibitor in small intestinal juice: its hydrolysis and protection by intraluminal factors.
1613792 1992 Three-dimensional structure of a recombinant variant of human pancreatic secretory trypsin inhibitor (Kazal type).
843082 1977 The primary structure of the human pancreatic secretory trypsin inhibitor. Amino acid sequence of the reduced S-aminoethylated protein.