Property Summary

NCBI Gene PubMed Count 192
PubMed Score 743.99
PubTator Score 1251.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
cystic fibrosis 1.900 2.9e-04
active Crohn's disease 1.045 2.9e-03
Barrett's esophagus 3.800 2.0e-02
colon cancer -2.100 6.6e-03
cutaneous lupus erythematosus -1.500 8.4e-03
esophageal adenocarcinoma 5.100 1.8e-02
interstitial cystitis -4.600 1.1e-02
intraductal papillary-mucinous neoplasm ... -2.000 1.7e-03
lung adenocarcinoma 2.900 1.9e-07
non-small cell lung cancer 1.865 2.5e-04
psoriasis -1.300 2.7e-02
spina bifida -2.121 3.5e-02
tuberculosis -3.200 3.2e-08
ulcerative colitis 1.100 1.6e-02

Gene RIF (213)

AA Sequence

MKVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTS      1 - 70
ILIQKSGPC                                                                  71 - 79
//

Text Mined References (193)

PMID Year Title