Property Summary

NCBI Gene PubMed Count 9
PubMed Score 24.21
PubTator Score 53.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Dent disease 18 3.862 1.9

Expression

Synonym

Accession Q99865 O75650 Q6IPW2 Q9UJJ0
Symbols DXF34
SPIN2
TDRD25
dJ323P24.1

Gene

  Ortholog (2)

Gene RIF (2)

AA Sequence

MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQKKQRGRPSSQPRRNIVGCRISHGWKEGDEPITQWKG      1 - 70
TVLDQVPINPSLYLVKYDGIDCVYGLELHRDERVLSLKILSDRVASSHISDANLANTIIGKAVEHMFEGE     71 - 140
HGSKDEWRGMVLAQAPIMKAWFYITYEKDPVLYMYQLLDDYKEGDLRIMPESSESPPTEREPGGVVDGLI    141 - 210
GKHVEYTKEDGSKRIGMVIHQVETKPSVYFIKFDDDFHIYVYDLVKKS                          211 - 258
//

Text Mined References (9)

PMID Year Title