Property Summary

NCBI Gene PubMed Count 27
PubMed Score 109.26
PubTator Score 3749.06

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Protein-protein Interaction (8)

Gene RIF (12)

AA Sequence

MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRRNIVGCRIQHGWKEGNGPVT      1 - 70
QWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHM     71 - 140
FETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSPPAEREPGEVV    141 - 210
DSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS                      211 - 262
//

Text Mined References (32)

PMID Year Title