Property Summary

NCBI Gene PubMed Count 168
PubMed Score 1091.99
PubTator Score 419.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Rheumatoid Arthritis -2.100 1.1e-02
psoriasis -1.600 4.3e-04
osteosarcoma -1.758 9.9e-03
non-small cell lung cancer -1.393 7.5e-17
lung carcinoma -1.700 9.8e-22

 GO Component (1)

Gene RIF (135)

PMID Text
27010793 The GATA-1-mediated inhibition of PU.1 gene transcription in human AML-erythroleukemias mediated through the URE represents important mechanism that contributes to PU.1 downregulation and leukemogenesis that is sensitive to DNA demethylation therapy
26942192 Our data suggest that E2A antagonism of PU.1 activity contributes to its ability to commit multipotential hematopoietic progenitors to the lymphoid lineages.
26851695 SPI1-GFI1B transcriptional network is an important regulatory axis in acute myeloid leukemia as well as in the development of erythroid versus myelomonocytic cell fate
26657848 Collectively, IMiDs exert demethylation activity through inhibiting DNMT1, 3a, and 3b, and up-regulating PU.1 expression, which may be one of the mechanisms of the anti-myeloma activity of IMiDs.
26429314 This study showed that HCV infection might abrogate NK cytotoxic potential through altering PU.1, NKG2D receptor and perforin molecules.
26261072 PU.1 downregulation was noted in B-CLL/SLL samples positive for the adverse prognostic markers CD38 and ZAP-70.
26149389 This study demonstrated positive regulation of monocyte/macrophage differentiation by lnc-MC and uncovered an elaborate regulation mechanism composed of PU.1, lnc-MC, miR-199a-5p, and ACVR1B.
26126967 PU.1 recruitment coupled with increased histone acetylation induces gene expression and activates a monocyte/macrophage transcriptional programme.
25987019 Loss of PU.1 expression is associated with Hepatocellular Carcinoma.
25205721 This review summarizes current knowledge and ideas of molecular mechanisms by which PU.1 controls hematopoiesis and suppresses leukemia. [review]
25185713 Runx-dependent PU.1 chromatin interaction and transcription of PU.1 are essential for both normal and leukemia stem cells.
25184385 The increased CITED2 expression in acute myeloid leukemia results in better hematopoietic stem cell survival, lower PU.1 levels, and perturbed myeloid differentiation program that contributes to leukemia persistence.
25092144 A novel network has been described in acute myeloid leukemia in which FLT3-ITD signaling induces oncogenic miR-155 by p65 and STAT5 thereby targeting transcription factor PU.1.
25072246 PU.1 suppressive target gene, metallothionein 1G, inhibits retinoic acid-induced NB4 cell differentiation.
25043887 The PU.1-regulated MAP1S gene is implicated in neutrophil differentiation and autophagy control.
25005557 hnRNP K and PU.1 act synergistically during granulocytic differentiation, hnRNP K seems to have a negative effect on PU.1 activity during monocytic maturation
24996056 IL-32theta; reduces PKCdelta-mediated phosphorylation of PU.1, resulting in attenuation of IL-1beta production
24952944 DNA complex may be relevant to an emerging role of PU.1, but not Ets-1, as a pioneer transcription factor in vivo
24908389 Mice with PU.1 deficiency in T cells were protected from colitis, whereas treatment with antibody to IL-9 suppressed colitis
24695740 Data indicate that transcription factors RUNX1 and PU.1 cooperated to exchange corepressors for coactivators, and deficiency of RUNX1, frequent in leukemia, caused aberrant recruitment of specific corepressors instead of coactivators to PU.1.
24639354 we have demonstrated that PU.1, GATA1, and GATA2 are involved in the expression of FcepsilonRI in a human mast cell line and primary human mast cells using siRNA with high transfection efficiency, and by ChIP assay.
24504023 HSF1 appears as a fine-tuning regulator of SPI1/PU.1 expression at the transcriptional and post-translational levels during macrophage differentiation of monocytes.
24498324 Data show that CCCTC-binding factor (CTCF) together with ISWI ATPase SMARCA5 and members of the Cohesin complex associate with the SPI1 protein is disrupted in acute myeloid leukemia (AML) blasts.
24445817 our findings demonstrate that PU.1 contributes to the development of MLL leukemia, partially via crosstalk with the MEIS/HOX pathway.
24379003 Given the importance of C/EBPs and PU.1 in myeloid development, these results, thus, suggest that restoration of the normal function of the myeloid cell transcriptional machinery is a major molecular mechanism underlying the differentiation induction
24086757 the expression control of Tal2 in hematopoietic cells
24038216 The tumor suppressor gene DAPK2 is induced by the myeloid transcription factors PU.1 and C/EBPalpha during granulocytic differentiation but repressed by PML-RARalpha in APL.
24028770 PU.1- targeted genes undergo Tet2-coupled demethylation and DNMT3b-mediated methylation in monocyte-to-osteoclast differentiation.
23770850 PML/RARalpha suppresses PU.1-dependent activation of the proteasome immunosubunits in acute promyelocytic leukemia.
23534406 TLR2 down-regulates FcepsilonRI and its transcription factor PU.1 in human Langerhans cells.
23501100 MT-1A is epigenetically regulated by PU.1 during monocytic differentiation.
23483680 These results show that PU.1 controls human microglial viability and function and suggest PU.1 as a molecular target for manipulation of human microglial phenotype.
23395001 PU.1 mediates chromosome looping and functions as a master regulator of HSC proliferation.
23252456 PU.1 and CEBPA are direct transcriptional regulators of CORO1A in acute promyelocytic leukemia and acute myeloid leukemia.
23212521 Data suggest that PU.1 is a potent tumor suppressor in classical Hodgkin lymphoma (cHL) and that induction of PU.1 with demethylation agents and/or histone deacetylase inhibitors is a possible therapeutic option for patients with cHL.
23118933 PU.1 sites may have served as anchor loci for the formation of new and functionally relevant PPARG binding sites throughout evolution.
22824976 PU.1 positively regulates the ST2 promoter as a transcription factor that directly transactivates the ST2 promoter via Ets-family-related cis-element in mast cells and basophils.
22780968 Epigenetic modification of PU.1 in chronic myeloid leukemia patients and K562 cell line might be responsible for the reduced expression of PU.1.
22674382 These data suggest that aberrant methylation of PU.1 may play a role in CML pathogenesis, and may therefore serve as a useful biomarker and potential target for demethylating drugs.
22569057 Low PU.1 expression in acute promyelocytic leukemia patients is required for disease initiation and progression.
22498738 HK3 is: (1) directly activated by PU.1, (2) repressed by PML-RARA, and (3) functionally involved in neutrophil differentiation and cell viability of acute promyelocytic leukemia cells.
22446486 Age- and differentiation-status-related epigenetic modifications of PU.1 is a unique regulator of Th9 memory acquisition and Th9 immunity.
22231443 results thus shed light on how PU.1 and Ikaros can act as lineage competency factors to facilitate both myeloid and lymphoid developmental programs
22145969 Transcriptional regulation of MIR29B by PU.1 (SPI1) and MYC during neutrophil differentiation of acute promyelocytic leukaemia cells.
22096565 Data show that IRF8 binds a large number of genes by targeting two distinct motifs, half of which are also targeted by PU.1.
22083997 Two signals are required for the self-renewal of Friend virus leukemia stem cells, proviral insertional activation of Spi1 and Hedgehog-dependent signaling.
22075620 the down-regulation of PU.1 expression suppresses the expression of SIRPalpha1.
22012064 Studies identified a physical and functional interaction between RUNX1 (AML1) and MLL and show that both are required to maintain the histone lysine 4 trimethyl mark (H3K4me3) at 2 critical regulatory regions of the AML1 target gene PU.1.
21897363 Upon macrophage differentiation PU.1 represses the miR-17-92 cluster promoter by an Egr-2/Jarid1b-mediated H3K4 demethylation mechanism whose deregulation may contribute to leukaemic states.
21789226 Expression of PU.1 downstream of activated JAK2 may explain why JAK2 mutations are frequently observed in myeloproliferative neoplasms patients.
21732487 PKCdelta regulated PU.1 activity by affecting its transactivation activity, whereas its DNA binding activity remained unaffected
21725055 IFN-gamma induces expression of PU.1 in human erythroid precursors.
21518930 RUNX1 deficiency is associated with persistent corepressor interaction with PU.1.
21474105 regulation of adult hematopoiesis through TIF1gamma-mediated transcriptional repression of TAL1 and PU.1 target genes.
21421043 PU.1 expression levels were increased in the monocytes of major depressive disorder patients, but not in those of schizophrenic or bipolar patients. PU.1 bound to both the TREM-1 & DAP12 promoters.
21402921 Data show that two transcription factors, PU.1 and C/EBPalpha, appear to synergistically mediate enhancer creation and affect NF-kappaB target selection in THP-1 cells.
21402070 PU.1 is a major transcriptional activator of LIMD1
21360505 A SNP in the 3'-untranslated region of SPI1 is associated with elevated SPI1 mRNA level and with susceptibility to systemic lupus erythematosus.
21239694 PU.1 regulates its expression in B cells and macrophages by differentially associating with cell type-specific transcription factors at one of its cis-regulatory elements
21216962 Positive regulatory domain I (PRDM1) and IRF8/PU.1 counter-regulate MHC class II transactivator (CIITA) expression during dendritic cell maturation.
21176776 ATRA up-regulates the expression of PU.1; and PU.1 preferentially binds to one of the two putative binding sites on the RIG-G promoter
21094529 CLEC5A expression in monocyte/macrophage and granulocytes is regulated by PU.1.
20947507 increased NF-kappaB activity leads to increased miR-155, which results in decreased PU.1, and consequently reduced CD10 mRNA and protein.
20660370 Spi-1 increases the speed of replication by acting specifically on elongation rather than enhancing origin firing.
20471086 ZNF300 was activated by PU.1 and suggested that the regulation may be involved in the progression of leukemia development and hematopoietic differentiation.
19966852 Here, we identified nuclear factor-kappaB (NF-kappaB) to activate PU.1 expression through a novel site within the upstream enhancer element.
19890096 Observational study of gene-disease association. (HuGE Navigator)
19828640 PU.1 is shown to be required for B cell receptor (BCR)-induced expression of positive regulatory domain I-binding factor 1 (PRDM1) in lymphoma cells and in PU.1-positive myeloma cells.
19825991 Collectively, we show that either activation of PU.1 or inhibition of GATA-1 efficiently reverses the transcriptional block imposed by GATA-1 and leads to the activation of a myeloid transcriptional program directed by PU.1.
19749795 PU.1 is capable of inducing apoptosis in certain myeloma cells by direct transactivation of TRAIL.
19747912 ATRA-induced increase of Vav1 expression and phosphorylation may be involved in recruiting PU.1 to the CD11b promoter and in regulating CD11b expression during the late stages of neutrophil differentiation of APL-derived promyelocytes.
19632992 Data show that PU.1 participates in the regulation of MD-2 in nonmyeloid cells cooperatively with C/EBPbeta.
19564417 The recruitment of BCL6 to promoter regions by PU.1 represents a new regulatory mechanism that expands the number of genes regulated by this important transcriptional repressor.
19542915 PU.1 is a valuable immunohistochemical marker for identifying cutaneous histiocyte- and dendritic cell-derived lesions
19502584 Reduced expression of mast cell-related molecules and transcription factors GATA-1/2 and up-regulation of C/EBPalpha in PU.1 transfectants indicate that enforced PU.1 suppresses mast cell-specific gene expression through these transcription factors.
19428102 we revealed the mRNA expression of annexin 1 was negatively correlated with PU.1 mRNA expression in 43 primary AML specimens
19386588 Transcription factors Oct-1, Oct-2, PU.1, Sp1, and Sp3 are recruited to the HS7 regulatory site in the pol coding region, suggesting that Oct-1, Oct-2, PU.1, Sp1, and Sp3 indirectly interact with HIV-1 Pol
19382896 This review focuses on important protein-protein interactions of PU.1 that play a crucial role in regulation of normal as well as malignant haematopoiesis.
19281794 PU.1 protein is cleaved into two fragments of 24 kDa and 16 kDa during apoptosis progression in leukemic cell lines and primary leukemic cells by caspase-3.
19208846 EVI1 point mutant, unable to bind PU.1, restores the activation of PU.1-regulated genes and allows a normal differentiation of bone marrow progenitors in vitro.
19158090 PU.1 directs Mi2beta to erase an established DNase I-hypersensitive site, in an ATP-dependent reaction subsequent to PU.1 binding to chromatin, whereas ACF will not support erasure
19118563 These data provide critical insights into the transcriptional regulation of the IP gene in human megakaryocytic and endothelial cells, identifying Sp1, PU.1 and Oct-1 as the critical factors involved in its basal regulation in humans.
19111020 LSECtin is expressed by liver myeloid cells, and its expression is dependent on the PU.1 transcription factor.
19076642 suggest that PU.1-binding motifs are essential for PARG promoter activity and that PU.1 modulates PARG gene expression during differentiation of HL-60 cells.
18676813 PU.1 expression is modulated by the balance of functional sense and antisense RNAs regulated by a shared cis-regulatory element.
18657865 PU.1 is involved in the regulation of human innate epithelial defences
18635311 PU.1 is severely impaired in patients with chronic myeloid leukemia but is restored upon treatment.
18316480 Arginine-methylated RUNX1 regulates PU.1 gene expression.
18308386 Low PU.1 levels were observed in monoblastic leukemias
18288635 These data provide evidence that NFATc1, in concert with PU.1, are involved in regulation of beta(3) integrin expression during osteoclast differentiation.
18056638 PU.1 activates the transcription of miR-424, and this up-regulation is involved in stimulating monocyte differentiation through miR-424-dependent translational repression of NFI-A
17694175 identify a single nucleotide polymorphism within this element in humans that is more frequent in acute myeloid leukemia with a complex karyotype, leads to decreased enhancer activity, and reduces PU.1 expression in myeloid progenitors
17671233 C/EBPalpha binds and activates the PU.1 distal enhancer to induce monocyte lineage.
17623651 Transcription factor PU.1 controls transcription start site positioning and alternative TLR4 promoter usage.
17621263 Ski-mediated repression of PU.1 is due to Ski's ability to recruit histone deacetylase 3 to PU.1 bound to DNA.
17562868 The type IV isoform of PML interacted with PU.1, promoted its association with p300, and then enhanced PU.1-induced transcription and granulocytic differentiation and PU.1 directly activates the transcription of the C/EBPepsilon gene.
17545613 PU.1 was down-regulated in the majority of human myeloma cell lines and a subset of freshly isolated myeloma cells, in contrast to relatively high expression of PU.1 in normal plasma cells.
17410194 data strongly indicate that germline mutations in SPI1 and MADD genes do not confer a high risk of chronic lymphocytic leukaemia and do not make a major contribution to the familial risk of the disease
17386941 IRF8 is involved in a cooperative interaction with transcription factors Spi-1/PU.1 and non-tyrosine phosphorylated Stat1 in the formation of a pre-associated, poised complex for interleukin 1-beta gene induction.
17218319 findings provide an insight into the structure of the hematopoietic cell-specific P2 promoter of the SHP-1 gene and identify PU.1 as the transcriptional activator of the P2 promoter
17200120 IRF8 cooperates with PU.1 and IRF-2 to activate a composite ets/IRF-cis element in the NF1 promoter. The conserved IRF domain tyrosine in ICSBP/IRF8 is required for interaction with the DNA-bound PU.1-IRF2 heterodimer.
16973891 The mechanism of action of VIP on monocyte differentiation may be via inhibition of the transcription factor PU.1.
16861236 PU.1-Ets domain and the GATA-1 C-terminal zinc finger (CF) form a low affinity interaction in which specific regions of each protein are implicated.
16698794 Spi-1 affects splicing decisions in a promoter binding-dependent manner
16642264 hydroquinone induces a dysregulation in the external signals modulating PU.1 protein phosphorylation and this dysregulation may be an early event in the generation of benzene-induced AML
16352814 PU.1 is suppressed in acute promyelocytic leukemia, and that all-trans retinoic acid restores PU.1 expression in cells harboring t(15;17).
16320347 The c.-292 T allele in the ALOX15 promoter generates a novel binding site for the transcription factor SPI1 that results in higher transcription of the gene in macrophages.
16298389 PU.1, in addition to its positive role in TAL-1 expression in early hematopoietic progenitors, may also act as a mediator of TAL-1 silencing in some hematopoietic lineages
16263717 c-Myb and c-Ets family members (Ets-1/2, PU.1, and Spi-B) control hGR 1A promoter regulation in T- and B-lymphoblast cells
16223775 PU.1 and Id2 modulate lineage options of langerhans cell precursors, downstream of TGF-beta1.
16149049 Our results indicate that the NMTS region of Runx1 is required for functional interactions with PU.1.
16083856 PU.1 regulates RANK gene transcription; this may represent one of the key roles of PU.1 in osteoclast differentiation
16061936 Transcription factors Oct-1, Oct-2, PU.1, Sp1, and Sp3 are recruited to the HS7 regulatory site in the pol coding region, suggesting that Oct-1, Oct-2, PU.1, Sp1, and Sp3 indirectly interact with HIV-1 Pol
16051608 PU.1 regulates the tissue-specific expression of dendritic cell-specific (ICAM)-3-grabbing nonintegrin.
15796964 Alteration of the PU.1 locus does not correlate with its suppressed expression in Hodgkin lymphoma.
15632149 nuclear import of the transcription factor PU.1 occurs via RanGTP-stimulated binding to Nup153
15625130 The expression of PU.1 is a critical event for osteoclastogenesis.
15598817 high PU.1 activity favors dendritic cells at the expense of macrophage fate by inhibiting expression and activity of the macrophage factor MafB.
15339679 Antibodies to LSP1 and PU.1 may represent useful reagents for the differential diagnosis between T-cell-rich B-cell lymphoma and lymphocyte-predominant Hodgkin's disease.
15304486 RANKL-induced cathepsin K gene expression is cooperatively regulated by the combination of the transcription factors and p38 MAP kinase in a gradual manner.
15242870 in B cells, E47 and PU.1/IRF-4 interact with the E-box motifs and the EICE, respectively, and act synergistically in the activation of CIITA-PIII
14706103 downregulated by Ehrlichia chaffeensis infection in monocytes
14647463 MeCP2 acts as a corepressor of PU.1 probably due to facilitating complex formation with mSin3A and HDACs.
14623259 In conclusion, we provide evidence for AML-1, PU.1, and Sp3 cooperatively and directly mediating BPI-expression during myeloid differentiation.
12896880 PU.1 is critical in the terminal differentiation of human alveolar macrophages.
12832449 PU.1 directly regulated the expression of only the glutathione peroxidase gene through binding sites in the promoter and a 3' regulatory region.
12778491 Transactivation & DNA-binding domains of PU.1 were required for induction of Stat6-mediated transcription. The co-operation of PU.1 & Stat6 in Igepsilon gene transactivation fine-tunes cell-type-restricted expression of IL-4-induced gene responses.
12393465 PU.1 transcriptional activity is down-regulated by AML1-ETO in t(8;21) myeloid leukemia by physical binding.
12202480 Interacts with other transcription factors to regulate transcription of the gene encoding eosinophil granule major basic protein
12130529 Distinct functions for STAT1 and PU.1 in transcriptional activation of Fc gamma receptor I promoter.
12130514 Heterozygous PU.1 mutations are associated with acute myeloid leukemia, causing disruption of PU.1 function, contributing to the block in cell differentiation found in AML patients.
12091339 C/EBPalpha and PU.1 interact physically and colocalize in myeloid cells, and C/EBPalpha blocks the function of PU.1.
12036891 Multiple PU.1 sites cooperate in the regulation of p40(phox) transcription during granulocytic differentiation of myeloid cells.
11929801 Loss of PU.1 expression is associated with defective immunoglobulin transcription in Hodgkin and Reed-Sternberg cells of classical Hodgkin disease.
11926990 PU.1 trans activation of gp91(phox) promoter

AA Sequence

MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNF      1 - 70
TELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQS     71 - 140
PPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALA    141 - 210
HRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRHPPH              211 - 270
//

Text Mined References (172)

PMID Year Title
27010793 2016 GATA-1 Inhibits PU.1 Gene via DNA and Histone H3K9 Methylation of Its Distal Enhancer in Erythroleukemia.
26942192 2016 E2A Antagonizes PU.1 Activity through Inhibition of DNA Binding.
26851695 2016 A somatic mutation of GFI1B identified in leukemia alters cell fate via a SPI1 (PU.1) centered genetic regulatory network.
26657848 2016 Immunomodulatory drugs act as inhibitors of DNA methyltransferases and induce PU.1 up-regulation in myeloma cells.
26429314 2015 Repressing PU.1 by miR-29a? in NK cells of HCV patients, diminishes its cytolytic effect on HCV infected cell models.
26261072 2015 Oncogenic microRNA-155 and its target PU.1: an integrative gene expression study in six of the most prevalent lymphomas.
26149389 2015 PU.1-Regulated Long Noncoding RNA lnc-MC Controls Human Monocyte/Macrophage Differentiation through Interaction with MicroRNA 199a-5p.
26126967 2016 Genome-scale definition of the transcriptional programme associated with compromised PU.1 activity in acute myeloid leukaemia.
25987019 2015 PU.1 Is Identified as a Novel Metastasis Suppressor in Hepatocellular Carcinoma Regulating the miR-615-5p/IGF2 Axis.
25205721 2014 Epigenetic control of hematopoiesis: the PU.1 chromatin connection.
25185713 2014 The Runx-PU.1 pathway preserves normal and AML/ETO9a leukemic stem cells.
25184385 2015 CITED2-mediated human hematopoietic stem cell maintenance is critical for acute myeloid leukemia.
25173106 2014 Genome-wide analysis of multi-ancestry cohorts identifies new loci influencing intraocular pressure and susceptibility to glaucoma.
25092144 2015 NF-?B/STAT5/miR-155 network targets PU.1 in FLT3-ITD-driven acute myeloid leukemia.
25072246 2014 A PU.1 suppressive target gene, metallothionein 1G, inhibits retinoic acid-induced NB4 cell differentiation.
25043887 2014 Induction of the autophagy-associated gene MAP1S via PU.1 supports APL differentiation.
25005557 2014 hnRNP K in PU.1-containing complexes recruited at the CD11b promoter: a distinct role in modulating granulocytic and monocytic differentiation of AML-derived cells.
24996056 2014 IL-32? negatively regulates IL-1? production through its interaction with PKC? and the inhibition of PU.1 phosphorylation.
24952944 2014 Mechanistic heterogeneity in site recognition by the structurally homologous DNA-binding domains of the ETS family transcription factors Ets-1 and PU.1.
24908389 2014 TH9 cells that express the transcription factor PU.1 drive T cell-mediated colitis via IL-9 receptor signaling in intestinal epithelial cells.
24695740 2014 Runx1 regulation of Pu.1 corepressor/coactivator exchange identifies specific molecular targets for leukemia differentiation therapy.
24639354 2014 Critical Roles for PU.1, GATA1, and GATA2 in the expression of human Fc?RI on mast cells: PU.1 and GATA1 transactivate FCER1A, and GATA2 transactivates FCER1A and MS4A2.
24504023 2014 Dual regulation of SPI1/PU.1 transcription factor by heat shock factor 1 (HSF1) during macrophage differentiation of monocytes.
24498324 2014 Epigenetic control of SPI1 gene by CTCF and ISWI ATPase SMARCA5.
24445817 2014 PU.1 is essential for MLL leukemia partially via crosstalk with the MEIS/HOX pathway.
24379003 2014 Enhancement of differentiation induction and upregulation of CCAAT/enhancer-binding proteins and PU.1 in NB4 cells treated with combination of ATRA and valproic acid.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24086757 2013 The T-cell oncogene Tal2 Is a Target of PU.1 and upregulated during osteoclastogenesis.
24038216 2014 The tumor suppressor gene DAPK2 is induced by the myeloid transcription factors PU.1 and C/EBP? during granulocytic differentiation but repressed by PML-RAR? in APL.
24028770 2013 PU.1 target genes undergo Tet2-coupled demethylation and DNMT3b-mediated methylation in monocyte-to-osteoclast differentiation.
23770850 2014 Coordinated regulation of the immunoproteasome subunits by PML/RAR? and PU.1 in acute promyelocytic leukemia.
23534406 2013 TLR2 down-regulates Fc?RI and its transcription factor PU.1 in human Langerhans cells.
23501100 2013 Epigenetic regulation of the metallothionein-1A promoter by PU.1 during differentiation of THP-1 cells.
23483680 2013 The transcription factor PU.1 is critical for viability and function of human brain microglia.
23395001 2013 Sustained PU.1 levels balance cell-cycle regulators to prevent exhaustion of adult hematopoietic stem cells.
23252456 2013 The actin-binding protein CORO1A is a novel PU.1 (SPI1)- and CEBPA-regulated gene with significantly lower expression in APL and CEBPA-mutated AML patients.
23212521 2013 PU.1 is a potent tumor suppressor in classical Hodgkin lymphoma cells.
23166356 2012 BCL6 positively regulates AID and germinal center gene expression via repression of miR-155.
23118933 2012 PPARG binding landscapes in macrophages suggest a genome-wide contribution of PU.1 to divergent PPARG binding in human and mouse.
22824976 2012 Involvement of PU.1 in mast cell/basophil-specific function of the human IL1RL1/ST2 promoter.
22780968 2012 [Down-regulation of transcription factor PU.1 via abnormal epigenetic modification in chronic myeloid leukemia].
22674382 2012 Down-regulation of hematopoiesis master regulator PU.1 via aberrant methylation in chronic myeloid leukemia.
22569057 2012 The significance of low PU.1 expression in patients with acute promyelocytic leukemia.
22498738 2012 PU.1 is linking the glycolytic enzyme HK3 in neutrophil differentiation and survival of APL cells.
22446486 2012 Maturation-related histone modifications in the PU.1 promoter regulate Th9-cell development.
22231443 2012 Ikaros represses and activates PU.1 cell-type-specifically through the multifunctional Sfpi1 URE and a myeloid specific enhancer.
22145969 2012 Transcriptional regulation of MIR29B by PU.1 (SPI1) and MYC during neutrophil differentiation of acute promyelocytic leukaemia cells.
22096565 2011 IRF8 governs expression of genes involved in innate and adaptive immunity in human and mouse germinal center B cells.
22083997 2012 Self-renewal of leukemia stem cells in Friend virus-induced erythroleukemia requires proviral insertional activation of Spi1 and hedgehog signaling but not mutation of p53.
22075620 2012 Correlation of PU.1 and signal regulatory protein ?1 expression in PU.1 transgenic K562 cells.
22012064 2011 The ability of MLL to bind RUNX1 and methylate H3K4 at PU.1 regulatory regions is impaired by MDS/AML-associated RUNX1/AML1 mutations.
21897363 2011 Epigenetic silencing of the oncogenic miR-17-92 cluster during PU.1-directed macrophage differentiation.
21789226 2011 JAK2 V617F-dependent upregulation of PU.1 expression in the peripheral blood of myeloproliferative neoplasm patients.
21732487 2011 PKC?-induced PU.1 phosphorylation promotes hematopoietic stem cell differentiation to dendritic cells.
21725055 2011 Chronic IFN-? production in mice induces anemia by reducing erythrocyte life span and inhibiting erythropoiesis through an IRF-1/PU.1 axis.
21575865 2011 Mechanistic rationale for inhibition of poly(ADP-ribose) polymerase in ETS gene fusion-positive prostate cancer.
21518930 2011 RUNX1 regulates corepressor interactions of PU.1.
21474105 2011 Adult hematopoiesis is regulated by TIF1?, a repressor of TAL1 and PU.1 transcriptional activity.
21421043 2011 TREM-1 and DAP12 expression in monocytes of patients with severe psychiatric disorders. EGR3, ATF3 and PU.1 as important transcription factors.
21402921 2011 PU.1 and C/EBP(alpha) synergistically program distinct response to NF-kappaB activation through establishing monocyte specific enhancers.
21402070 2011 PU.1 is a major transcriptional activator of the tumour suppressor gene LIMD1.
21360505 2011 Association of a functional polymorphism in the 3'-untranslated region of SPI1 with systemic lupus erythematosus.
21239694 2011 Two distinct auto-regulatory loops operate at the PU.1 locus in B cells and myeloid cells.
21216962 2011 Positive regulatory domain I (PRDM1) and IRF8/PU.1 counter-regulate MHC class II transactivator (CIITA) expression during dendritic cell maturation.
21176776 2011 PU.1 directly regulates retinoic acid-induced expression of RIG-G in leukemia cells.
21094529 2011 CLEC5A (MDL-1) is a novel PU.1 transcriptional target during myeloid differentiation.
20947507 2011 NF-kappaB down-regulates expression of the B-lymphoma marker CD10 through a miR-155/PU.1 pathway.
20660370 2010 Spi-1/PU.1 oncogene accelerates DNA replication fork elongation and promotes genetic instability in the absence of DNA breakage.
20471086 2010 PU.1 can regulate the ZNF300 promoter in APL-derived promyelocytes HL-60.
20159610 2010 PML/RARalpha targets promoter regions containing PU.1 consensus and RARE half sites in acute promyelocytic leukemia.
20139074 2010 Metallothionein-1 isoforms and vimentin are direct PU.1 downstream target genes in leukemia cells.
19966852 2010 PU.1 is regulated by NF-kappaB through a novel binding site in a 17 kb upstream enhancer element.
19890096 2010 Heterozygous deletion of the PU.1 locus in human AML.
19828640 2009 PU.1 regulates positive regulatory domain I-binding factor 1/Blimp-1 transcription in lymphoma cells.
19825991 2009 PU.1 activation relieves GATA-1-mediated repression of Cebpa and Cbfb during leukemia differentiation.
19749795 2009 PU.1 induces apoptosis in myeloma cells through direct transactivation of TRAIL.
19747912 2010 Vav1 and PU.1 are recruited to the CD11b promoter in APL-derived promyelocytes: role of Vav1 in modulating PU.1-containing complexes during ATRA-induced differentiation.
19632992 2009 Cooperation between PU.1 and CAAT/enhancer-binding protein beta is necessary to induce the expression of the MD-2 gene.
19564417 2009 PU.1 can recruit BCL6 to DNA to repress gene expression in germinal center B cells.
19542915 2009 The utility of PU.1 as an immunohistochemical marker for histiocytic and dendritic lesions of the skin.
19502584 2009 Roles of PU.1 in monocyte- and mast cell-specific gene regulation: PU.1 transactivates CIITA pIV in cooperation with IFN-gamma.
19428102 2009 Identification of annexin 1 as a PU.1 target gene in leukemia cells.
19382896 PU.1 and partners: regulation of haematopoietic stem cell fate in normal and malignant haematopoiesis.
19281794 2009 PU.1, a novel caspase-3 substrate, partially contributes to chemotherapeutic agents-induced apoptosis in leukemic cells.
19208846 2009 EVI1 Impairs myelopoiesis by deregulation of PU.1 function.
19158090 2009 Mi2beta shows chromatin enzyme specificity by erasing a DNase I-hypersensitive site established by ACF.
19118563 2009 Transcriptional regulation of the human prostacyclin receptor gene is dependent on Sp1, PU.1 and Oct-1 in megakaryocytes and endothelial cells.
19111020 2009 The pathogen receptor liver and lymph node sinusoidal endotelial cell C-type lectin is expressed in human Kupffer cells and regulated by PU.1.
19076642 2008 Characterization of the promoter region of the human PARG gene and its response to PU.1 during differentiation of HL-60 cells.
18692240 2009 Physical and functional interactions between hematopoietic cell-specific ETS transcription factors and homeodomain proteins.
18676813 2008 PU.1 expression is modulated by the balance of functional sense and antisense RNAs regulated by a shared cis-regulatory element.
18657865 2008 PU.1 and bacterial metabolites regulate the human gene CAMP encoding antimicrobial peptide LL-37 in colon epithelial cells.
18635311 2008 PU.1 expression is restored upon treatment of chronic myeloid leukemia patients.
18316480 2008 Methylation of RUNX1 by PRMT1 abrogates SIN3A binding and potentiates its transcriptional activity.
18308386 2008 PU.1 and CEBPA expression in acute myeloid leukemia.
18288635 2008 PU.1 and NFATc1 mediate osteoclastic induction of the mouse beta3 integrin promoter.
18056638 2007 The interplay between the master transcription factor PU.1 and miR-424 regulates human monocyte/macrophage differentiation.
17694175 2007 A distal single nucleotide polymorphism alters long-range regulation of the PU.1 gene in acute myeloid leukemia.
17671233 2007 C/EBPalpha binds and activates the PU.1 distal enhancer to induce monocyte lineage commitment.
17623651 2007 Transcription factor PU.1 controls transcription start site positioning and alternative TLR4 promoter usage.
17621263 2008 Ski can negatively regulates macrophage differentiation through its interaction with PU.1.
17562868 2007 PML-retinoic acid receptor alpha inhibits PML IV enhancement of PU.1-induced C/EBPepsilon expression in myeloid differentiation.
17545613 2007 Down-regulation of PU.1 by methylation of distal regulatory elements and the promoter is required for myeloma cell growth.
17410194 2007 Germline mutations in SPI1 and MADD do not contribute to familial chronic lymphocytic leukaemia.
17386941 2007 Phosphorylation of IRF8 in a pre-associated complex with Spi-1/PU.1 and non-phosphorylated Stat1 is critical for LPS induction of the IL1B gene.
17218319 2007 PU.1 activates transcription of SHP-1 gene in hematopoietic cells.
17200120 2007 PU.1, interferon regulatory factor (IRF) 2, and the interferon consensus sequence-binding protein (ICSBP/IRF8) cooperate to activate NF1 transcription in differentiating myeloid cells.
17197705 2007 The transcriptional repressor GFI-1 antagonizes PU.1 activity through protein-protein interaction.
16973891 2007 Pivotal advance: vasoactive intestinal peptide inhibits up-regulation of human monocyte TLR2 and TLR4 by LPS and differentiation of monocytes to macrophages.
16861236 2006 Molecular analysis of the interaction between the hematopoietic master transcription factors GATA-1 and PU.1.
16698794 2006 Spi-1/PU.1 oncoprotein affects splicing decisions in a promoter binding-dependent manner.
16642264 2006 PU.1 phosphorylation correlates with hydroquinone-induced alterations in myeloid differentiation and cytokine-dependent clonogenic response in human CD34(+) hematopoietic progenitor cells.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16352814 2006 ATRA resolves the differentiation block in t(15;17) acute myeloid leukemia by restoring PU.1 expression.
16320347 2006 Functional polymorphism in ALOX15 results in increased allele-specific transcription in macrophages through binding of the transcription factor SPI1.
16298389 2006 PU.1/Spi-1 binds to the human TAL-1 silencer to mediate its activity.
16263717 2005 c-Myb and members of the c-Ets family of transcription factors act as molecular switches to mediate opposite steroid regulation of the human glucocorticoid receptor 1A promoter.
16223775 2006 Differential involvement of PU.1 and Id2 downstream of TGF-beta1 during Langerhans-cell commitment.
16149049 2005 Subnuclear targeting of Runx1 is required for synergistic activation of the myeloid specific M-CSF receptor promoter by PU.1.
16083856 2005 The hematopoietic transcription factor PU.1 regulates RANK gene expression in myeloid progenitors.
16051608 2005 PU.1 regulates the tissue-specific expression of dendritic cell-specific intercellular adhesion molecule (ICAM)-3-grabbing nonintegrin.
15796964 2005 Alterations of loci encoding PU.1, BOB1, and OCT2 transcription regulators do not correlate with their suppressed expression in Hodgkin lymphoma.
15632149 2005 Carrier-independent nuclear import of the transcription factor PU.1 via RanGTP-stimulated binding to Nup153.
15625130 2005 Enforced expression of PU.1 rescues osteoclastogenesis from embryonic stem cells lacking Tal-1.
15598817 2005 Balance of MafB and PU.1 specifies alternative macrophage or dendritic cell fate.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15339679 2004 Leukocyte-specific phosphoprotein-1 and PU.1: two useful markers for distinguishing T-cell-rich B-cell lymphoma from lymphocyte-predominant Hodgkin's disease.
15304486 2004 Essential role of p38 mitogen-activated protein kinase in cathepsin K gene expression during osteoclastogenesis through association of NFATc1 and PU.1.
15242870 2004 E47, IRF-4, and PU.1 synergize to induce B-cell-specific activation of the class II transactivator promoter III (CIITA-PIII).
14706103 2004 Ehrlichia chaffeensis downregulates surface Toll-like receptors 2/4, CD14 and transcription factors PU.1 and inhibits lipopolysaccharide activation of NF-kappa B, ERK 1/2 and p38 MAPK in host monocytes.
14647463 2003 Direct association between PU.1 and MeCP2 that recruits mSin3A-HDAC complex for PU.1-mediated transcriptional repression.
14623259 2003 AML-1, PU.1, and Sp3 regulate expression of human bactericidal/permeability-increasing protein.
12896880 2003 PU.1 regulation of human alveolar macrophage differentiation requires granulocyte-macrophage colony-stimulating factor.
12833137 2003 CDK6 blocks differentiation: coupling cell proliferation to the block to differentiation in leukemic cells.
12832449 2003 PU.1 regulates glutathione peroxidase expression in neutrophils.
12778491 2003 PU.1 is required for transcriptional activation of the Stat6 response element in the Igepsilon promoter.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393465 2003 The myeloid master regulator transcription factor PU.1 is inactivated by AML1-ETO in t(8;21) myeloid leukemia.
12372320 2002 Crystallization and characterization of PU.1/IRF-4/DNA ternary complex.
12202480 2002 Novel combinatorial interactions of GATA-1, PU.1, and C/EBPepsilon isoforms regulate transcription of the gene encoding eosinophil granule major basic protein.
12130529 2002 Distinct functions for signal transducer and activator of transcription 1 and PU.1 in transcriptional activation of Fc gamma receptor I promoter.
12130514 2002 Heterozygous PU.1 mutations are associated with acute myeloid leukemia.
12091339 2002 Granulocyte inducer C/EBPalpha inactivates the myeloid master regulator PU.1: possible role in lineage commitment decisions.
12036891 2002 Multiple PU.1 sites cooperate in the regulation of p40(phox) transcription during granulocytic differentiation of myeloid cells.
11926990 2002 PU.1 is dominant and HAF-1 supplementary for activation of the gp91(phox) promoter in human monocytic PLB-985 cells.
11181995 2001 The sequence of the human genome.
11133986 2001 AKT induces transcriptional activity of PU.1 through phosphorylation-mediated modifications within its transactivation domain.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10867017 2000 The hematopoietic transcription factor PU.1 represses gelatinase A transcription in glomerular mesangial cells.
10734131 2000 PU.1 and interferon consensus sequence-binding protein regulate the myeloid expression of the human Toll-like receptor 4 gene.
10411939 1999 Negative cross-talk between hematopoietic regulators: GATA proteins repress PU.1.
10364157 1999 Direct interaction of hematopoietic transcription factors PU.1 and GATA-1: functional antagonism in erythroid cells.
10207087 1999 Functional and physical interactions between AML1 proteins and an ETS protein, MEF: implications for the pathogenesis of t(8;21)-positive leukemias.
10196196 1999 SPI-B activates transcription via a unique proline, serine, and threonine domain and exhibits DNA binding affinity differences from PU.1.
10050886 1999 Physical and functional interactions between the transcription factor PU.1 and the coactivator CBP.
10022840 1999 Assembly requirements of PU.1-Pip (IRF-4) activator complexes: inhibiting function in vivo using fused dimers.
9918847 1999 Microphthalmia-associated transcription factor interacts with PU.1 and c-Fos: determination of their subcellular localization.
9681824 1998 Erg proteins, transcription factors of the Ets family, form homo, heterodimers and ternary complexes via two distinct domains.
9600921 1998 PU.1 as an essential activator for the expression of gp91(phox) gene in human peripheral neutrophils, monocytes, and B lymphocytes.
9478924 1998 The transcription factor Spi-1/PU.1 interacts with the potential splicing factor TLS.
9376596 1997 Human T-cell leukemia virus type I Tax transactivates the promoter of human prointerleukin-1beta gene through association with two transcription factors, nuclear factor-interleukin-6 and Spi-1.
9211934 1997 PU.1 is essential for p47(phox) promoter activity in myeloid cells.
9094628 1997 Physical interactions between Ets and NF-kappaB/NFAT proteins play an important role in their cooperative activation of the human immunodeficiency virus enhancer in T cells.
8626664 1996 The transcription factor Spi-1/PU.1 binds RNA and interferes with the RNA-binding protein p54nrb.
8434021 1993 The activation domain of transcription factor PU.1 binds the retinoblastoma (RB) protein and the transcription factor TFIID in vitro: RB shows sequence similarity to TFIID and TFIIB.
8219191 1993 Hematopoietic lineage- and stage-restricted expression of the ETS oncogene family member PU.1.
7730336 1995 Activating transcription factor 1 and cyclic AMP response element modulator can modulate the activity of the immunoglobulin kappa 3' enhancer.
7594592 1995 Multiple proteins physically interact with PU.1. Transcriptional synergy with NF-IL6 beta (C/EBP delta, CRP3).
7478579 1995 PU.1 (Spi-1) autoregulates its expression in myeloid cells.
2338340 1990 Localization of the human oncogene SPI1 on chromosome 11, region p11.22.
2180582 1990 The macrophage and B cell-specific transcription factor PU.1 is related to the ets oncogene.
1693183 1990 The human homologue of the putative proto-oncogene Spi-1: characterization and expression in tumors.