Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.48
PubTator Score 29.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytoma -1.200 1.7e-05
glioblastoma -3.500 4.8e-05
osteosarcoma 1.058 5.2e-03
posterior fossa group A ependymoma -3.800 3.9e-13
group 3 medulloblastoma -4.700 4.7e-06
non diabetic and post-ischemic heart fai... 1.100 1.3e-02
atypical teratoid / rhabdoid tumor -4.200 1.6e-10
medulloblastoma, large-cell -4.100 4.2e-05
primitive neuroectodermal tumor -3.400 3.4e-03
adult high grade glioma -3.400 2.3e-06
pilocytic astrocytoma -4.500 2.3e-11
subependymal giant cell astrocytoma -4.205 3.7e-03
lung carcinoma 5.900 2.5e-60
Alzheimer's disease -1.300 3.7e-02
Pick disease -1.700 2.4e-03
Breast cancer -1.800 2.6e-24

Synonym

Accession Q2M3C7 Q68DA3 Q68DR8 Q9C0I5
Symbols SKIP

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (9)

PMID Text
22479372 Results showed that DPP6, SPHKAP and ID4 were down regulated in acute myeloid leukemia (AML) patients.
22084075 SKIP is an entirely specific type I A-kinase anchoring protein that can sequester two molecules of protein kinase A at mitochondria.
20394097 sphingosine kinase type 1-interacting protein can be considered as the first mammalian A-kinase-anchoring proteins that preferentially binds to regulatory subunit 1 of cAMP-dependent protein kinase.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18055454 HIF-1 and HIF-2 have roles in SK1 upregulation during hypoxia in glioma cells
17325258 Hyperglycemia stimulates SK1 activity via protein kinase C and oxidative stress-dependent pathways, leading to decreased apoptosis in vvascular smooth muscle.
17164439 Uterine expression of SphK1 mediates processes involved in growth and differentiation of uterine tissues during pregnancy.
15485866 experiments demonstrate that sphingosine kinase 1/sphingosine-1-phosphate are important components of the transforming growth factor-beta signaling pathway involved in up-regulation of the tissue inhibitor of metalloproteinase-1 (TIMP-1)
12080051 cloning and characterization; results indicate that SKIP is a novel protein likely to play a regulatory role in the modulation of sphingosine kinase type 1 (SPHK1) activity

AA Sequence

MDGNSLLSVPSNLESSRMYDVLEPQQGRGCGSSGSGPGNSITACKKVLRSNSLLESTDYWLQNQRMPCQI      1 - 70
GFVEDKSENCASVCFVNLDVNKDECSTEHLQQKLVNVSPDLPKLISSMNVQQPKENEIVVLSGLASGNLQ     71 - 140
ADFEVSQCPWLPDICLVQCARGNRPNSTNCIIFEINKFLIGLELVQERQLHLETNILKLEDDTNCSLSSI    141 - 210
EEDFLTASEHLEEESEVDESRNDYENINVSANVLESKQLKGATQVEWNCNKEKWLYALEDKYINKYPTPL    211 - 280
IKTERSPENLTKNTALQSLDPSAKPSQWKREAVGNGRQATHYYHSEAFKGQMEKSQALYIPKDAYFSMMD    281 - 350
KDVPSACAVAEQRSNLNPGDHEDTRNALPPRQDGEVTTGKYATNLAESVLQDAFIRLSQSQSTLPQESAV    351 - 420
SVSVGSSLLPSCYSTKDTVVSRSWNELPKIVVVQSPDGSDAAPQPGISSWPEMEVSVETSSILSGENSSR    421 - 490
QPQSALEVALACAATVIGTISSPQATERLKMEQVVSNFPPGSSGALQTQAPQGLKEPSINEYSFPSALCG    491 - 560
MTQVASAVAVCGLGEREEVTCSVAPSGSLPPAAEASEAMPPLCGLASMELGKEAIAKGLLKEAALVLTRP    561 - 630
NTYSSIGDFLDSMNRRIMETASKSQTLCSENVVRNELAHTLSNVILRHSIDEVHHKNMIIDPNDNRHSSE    631 - 700
ILDTLMESTNQLLLDVICFTFKKMSHIVRLGECPAVLSKETIRRRETEPSCQPSDPGASQAWTKATESSS    701 - 770
SSPLSNSHNTSLVINNLVDGMYSKQDKGGVRPGLFKNPTLQSQLSRSHRVPDSSTATTSSKEIYLKGIAG    771 - 840
EDTKSPHHSENECRASSEGQRSPTVSQSRSGSQEAEESIHPNTQEKYNCATSRINEVQVNLSLLGDDLLL    841 - 910
PAQSTLQTKHPDIYCITDFAEELADTVVSMATEIAAICLDNSSGKQPWFCAWKRGSEFLMTPNVPCRSLK    911 - 980
RKKESQGSGTAVRKHKPPRLSEIKRKTDEHPELKEKLMNRVVDESMNLEDVPDSVNLFANEVAAKIMNLT    981 - 1050
EFSMVDGMWQAQGYPRNRLLSGDRWSRLKASSCESIPEEDSEARAYVNSLGLMSTLSQPVSRASSVSKQS   1051 - 1120
SCESITDEFSRFMVNQMENEGRGFELLLDYYAGKNASSILNSAMQQACRKSDHLSVRPSCPSKQSSTESI   1121 - 1190
TEEFYRYMLRDIERDSRESASSRRSSQDWTAGLLSPSLRSPVCHRQSSMPDSRSPCSRLTVNVPIKANSL   1191 - 1260
DGFAQNCPQDFLSVQPVSSASSSGLCKSDSCLYRRGGTDHITNMLIHETWASSIEALMRKNKIIVDDAEE   1261 - 1330
ADTEPVSGGSPSQAEKCANRLAASRMCSGPTLLVQESLDCPRKDSVTECKQPPVSSLSKTASLTNHSPLD   1331 - 1400
SKKETSSCQDPVPINHKRRSLCSREVPLIQIETDQREACAGEPEPFLSKSSLLEEAEGHSNDKNIPDVVR   1401 - 1470
GGDTAVSACQIHSDSLDTRDVPEAEASTEARAPDEAPNPPSSSEESTGSWTQLANEEDNPDDTSSFLQLS   1471 - 1540
ERSMSNGNSSATSSLGIMDLDIYQESMPSSPMINELVEEKKILKGQSESTEAPASGPPTGTASPQRSLLV   1541 - 1610
INFDLEPECPDAELRATLQWIAASELGIPTIYFKKSQENRIEKFLDVVQLVHRKSWKVGDIFHAVVQYCK   1611 - 1680
MHEEQKDGRLSLFDWLLELG                                                     1681 - 1700
//

Text Mined References (16)

PMID Year Title
23568457 2013 Genetic variants associated with disordered eating.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22479372 2012 Genome wide analysis of acute myeloid leukemia reveal leukemia specific methylome and subtype specific hypomethylation of repeats.
22084075 2011 An entirely specific type I A-kinase anchoring protein that can sequester two molecules of protein kinase A at mitochondria.
20394097 2010 Sphingosine kinase interacting protein is an A-kinase anchoring protein specific for type I cAMP-dependent protein kinase.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18055454 2008 Sphingosine kinase 1 is up-regulated during hypoxia in U87MG glioma cells. Role of hypoxia-inducible factors 1 and 2.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17325258 2007 Activation of sphingosine kinase-1 mediates inhibition of vascular smooth muscle cell apoptosis by hyperglycemia.
17164439 2007 Progesterone-induced sphingosine kinase-1 expression in the rat uterus during pregnancy and signaling consequences.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485866 2004 Sphingosine kinase 1 (SPHK1) is induced by transforming growth factor-beta and mediates TIMP-1 up-regulation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12080051 2002 Cloning and characterization of a protein kinase A anchoring protein (AKAP)-related protein that interacts with and regulates sphingosine kinase 1 activity.
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.