Property Summary

NCBI Gene PubMed Count 188
PubMed Score 514.08
PubTator Score 400.59

Knowledge Summary

Patent (18,734)

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis 1.900 7.6e-05
osteosarcoma 1.518 9.8e-03
posterior fossa group A ependymoma 1.600 5.7e-10
glioblastoma 1.700 5.3e-04
tuberculosis -2.300 5.7e-07
intraductal papillary-mucinous adenoma (... -1.200 3.0e-04
cystic fibrosis 1.200 3.9e-04
pediatric high grade glioma 1.400 2.9e-04
sonic hedgehog group medulloblastoma 2.200 3.9e-04
ovarian cancer 1.100 2.3e-02

Gene RIF (170)

PMID Text
26886371 increased SK and SPL mRNA expression along with reduced sphingosine 1-phosphate levels were more commonly observed in hepatocellular carcinoma tissues.
26842184 Sphk1 plays an important role in the malignant transformation of breast epithelial cells and modulates breast cancer metastasis through the regulation of Ecadherin expression.
26716409 High SPHK1 expression is associated with ovarian cancer.
26590717 Results reveal an lncRNA- and E2F1-driven regulatory loop in which E2F1-dependent induction of antisense RNA leads to changes in chromatin structure, facilitating E2F1-dependent expression of SPHK1 and restriction of E2F1-induced apoptosis.
26549227 MiR-506 suppresses the angiogenesis of liver cancer by inhibiting SPHK1.
26540633 Data show that long non-coding RNA HULC promotes tumor angiogenesis in liver cancer through microRNA miR-107/E2F1 transcription factor (E2F1)/sphingosine kinase 1 (SPHK1) signaling.
26493335 High SPHK1 protein correlated with resistance to cisplatin (IC50) in an independent gastric cancer cell line panel and with survival of patients treated with chemotherapy prior to surgery but not in patients treated with surgery alone.
26376826 In summary, this study demonstrates a link between SphK1/sphingosine-1-phosphate and TGF-beta-induced miR-21 in renal tubular epithelial cells.
26311741 SPHK1 is involved in tumor development and progression of cervical cancer
26264277 The silencing of SphK1 potentiated the apoptotic effects of the green tea polyphenol epigallocatechin-3-O-gallate.
26073327 Hepatitis B virus X protein is able to elevate the expression of SPHK1 in hepatoma cells by upregulating transcription factor AP2 alpha.
26071354 results indicate that miR-101 exerts its anti-CRC activities probably through down-regulating SphK1
26045781 Resveratrol-induced proliferation inhibition of K562 cells might be mediated through its modulation activity of SphK1 pathway by regulating S1P and ceramide levels, which then affected the proliferation and apoptosis process of leukemia cells.
25892494 A novel chimeric aequorin fused with caveolin-1 reveals a sphingosine kinase 1-regulated Ca(2) microdomain in the caveolar compartment.
25805832 SK1 is overexpressed in 786-0 renal carcinoma cells lacking functional VHL, with concomitant high sphingosine 1-phosphate levels that appear to be HIF-2alpha mediated.
25786072 In contrast to the SK activity, S1PP activity was homogeneous across the peripheral blood NK cells, suggesting a bias in the SK pathway towards proliferation and migration, activities supported by S1P.
25778867 results suggest for the first time that SPHK1 is involved in the development and progression of NPC, which can be used as a useful prognostic marker for NPC patients and may be an effective target for treating NPC
25671829 SPHK1 might represent a novel and useful prognostic marker of hepatocellular carcinoma progression in patients with portal vein tumor thrombus.
25587035 the A2B adenosine receptor (ADORA2B) is essential for adenosine-induced SphK1 activity in human and mouse normal and sickle erythrocytes in vitro
25537088 The specific Sphk1 inhibitor DMS can play a therapeutic role.
25481644 Our findings demonstrate that leptin-induced STAT3 is partially cross activated through SK1-mediated IL6 secretion and gp130 activation. Positive correlations in human tissues suggest the potential significance of this pathway in ER-negative breast cancer
25417698 induced pluripotent stem cell derived human Niemann-Pick type C disease neurons are generated and the abnormalities caused by VEGF/SphK inactivity in these cells are corrected by replenishment of VEGF.
25411162 E2F7 directly increases the transcription and activity of the Sphk1/S1P axis resulting in activation of AKT and subsequent drug resistance.
25404266 Data suggest that sphingosine kinase 1 (SPHK1) is involved in the regulation of small cell lung cancer multi-drug resistance, and a target gene to evaluate the chemosensitivity and clinical prognostic for small cell lung cancer (SCLC).
25319495 This establishes that sphingosine kinase, in addition to producing sphingosine-1-phosphate as a signaling molecule, also consumes dihydrosphingosine to regulate ceramide synthesis.
25310737 these data indicated that Sphk1 inhibition plays an important role in caspase-dependent apoptotic neuronal death in an experimental Parkinson's disease model
25260803 Sacral chordoma patients with high expression of SPHK1 possessed shorter continuous disease-free survival time.
25176316 oxLDL induced angiogenesis requires SPHK1/S1P signalling both in vitro in a HMEC-1 tube formation model and in vivo in the murine Matrigel plug model
25109605 SphK1 confers resistance to apoptosis in gastric cancer cells via the Akt/FoxO3a/Bim pathway.
24903384 Data show that sphingosine kinase SphK1 and sphingosine-1-phosphate (S1P) receptors S1P1, S1P2, S1P3, and S1P5 were expressed from primary, up to recurrent and secondary glioblastomas, with sphingosine kinase SphK2 levels were highest in primary tumors.
24816639 Knockdown of SPHK1 expression inhibits the PI3K/AKT activation, MMP-2 and MMP-9 expression, and human RA-FLS migration and invasion in vitro. Potentially, SPHK1 may be a novel therapeutic target for rheumatoid arthritis.
24503067 Sphingosine kinase 1 regulates measles virus replication.
24473437 this study delineates a novel role for sphingosine kinase 1 (SK1) in metabolic disorders associated with obesity
24468113 The results highlight the importance of S1P in AD suggesting the existence of a global deregulation of S1P signaling in this disease from its synthesis by SphK1 and degradation by SPL to its signaling by the S1P1 receptor.
24452756 Endogenously liberated amyloid Beta peptides significantly decreases expression and activity of SPK1.
24422628 IGF1R mediates insulin-stimulated phosphorylation of both SphK1 and SphK2.
24337110 suggest that combined inhibition of epidermal growth factor receptor and sphingosine kinase-1 has potential as an anticancer therapy in triple-negative breast cancer in which insulin-like growth factor-binding protein-3 expression is high.
24276247 these findings suggest that TFR1 has an important role in sphingosine kinase 1-mediated oncogenesis.
24162774 HIV-1 gp120 upregulates the expression of sphingosine kinase 1 (SPHK1) in human B cells
24137500 SK is a key pro-viral factor regulating multiple cellular signal pathways triggered by influenza virus infection
24092575 increased expression of SPHK1 may be involved in the pathogenesis and progression of bladder cancer
23955546 SphK1 may be a predictive factor for treatment outcome after neoadjuvant treatment in luminal type breast cancers.
23939980 We propose that the reduction in SphK1 activity late in DENV-2-infected cells is a consequence of DENV-2 out-competing SphK1 for eEF1A binding and hijacking cellular eEF1A for its own replication strategy.
23928990 High sphingosine kinase 1 is associated with breast cancer.
23893239 SPHK1 expression was increased in cancer versus non-cancer tissue in patients with cutaneous melanoma and this corroborates previous reports showing that the levels of SPHK1 mRNA and protein are higher in malignant tumors than in healthy tissues.
23861887 the SPHK rheostat does not play a major role in tumor cell viability, and that SPHKs might not be attractive targets for pharmacological intervention in the area of oncology.
23839903 Demonstrate that HPPCn attenuated oxidative injury and fibrosis induced by ethanol feeding and that the SphK1/S1P/S1PRs signalling pathway contributes to this protective effect.
23658376 In carotid artery plaque, expression of SPHK1 was observed at smooth muscle cell-rich sites and was co-localized with intraplaque FX/FXa content.
23651497 The H2O2-induced src/PDGFRbeta/SK1 signaling cascade was impaired in nSMase2-deficient fro/fro cells and was rescued by exogenous C2Cer that activated src/PDGFRbeta/SK1.
23602659 SphK1 recognizes the lipid substrate and catalyzes ATP-dependent phosphorylation.
23576579 SPHK1 overexpression modulates intestinal cell proliferation through increased c-Myc translation.
23466305 key role of Sphk1, S1PR1 and S1PR3 in angiogenesis underlying the liver fibrosis process
23462226 We are herein provide the first evidence of increased SPHK-1 expression in post-labor amnions, and that sphingosine-1-phosphate increases the PTGS-2 expression in amnion cells
23426175 SPHK1 contributes toward the regulation of CD44 protein expression through the ERK signaling pathway through sphingosine-1-phosphate in human colon cancer cells.
23359503 The function of SphK1 and SphK2 can be interchangeable in mast cells and is species and cell type determined.
23314175 Sphingosine kinase 1 functions to increase the stability of c-Myc and suppresses Ap3A formation, which might maintain the Warburg effect and cell survival.
23232649 SphK1 regulates tumor cell proliferation, apoptosis and invasion, which ultimately contributes to tumor progression and malignancy phenotype in colon cancer. FAK pathway, ICAM-1 and VCAM-1 may play critical roles in this SphK1mediated effect.
23166225 a correlation between SphK1 expression and cetuximab response was found in colorectal cancer patients.
22961081 Data have identified that the enzyme SphK1 is an important regulator of lipid partitioning and insulin action in skeletal muscle under conditions of increased lipid supply.
22833671 Oncogenic K-Ras regulates bioactive sphingolipids in a sphingosine kinase 1-dependent manner
22781898 Overexpression of SphK1 and NF-kappaB may be involved in the pathogenesis and progression of colon carcinoma.
22733311 findings identify a novel role for the nuclear localization of sphingosine kinase 1 combined with either ERK-1/2 or SFK or LYN or AKT or NF-kappaB, which significantly shortens disease-specific survival and/or recurrence in estrogen receptor positive breast cancer
22684547 SphK1 promoting the secretion of MMP-2/9 and uPA via activation of ERK1/2 and suppression of p38 MAPK pathways maybe the molecular mechanisms for its regulation of the malignant behavior of colon cancer cell.
22460268 findings highlight an important role for S1P(4) and SK1 in ER(-) breast cancer progression.
22450659 miR-124 inhibits cell proliferation in gastric cancer through down-regulation of SPHK1.
22422617 Data suggest that sphingosine 1-phosphate receptor 1 transactivation is dependent on SPHK1, is upstream of MAP kinase signaling system, and is required for LDL-regulated expression of connective tissue growth factor in mesangial cells.
22331716 Results that antineoplastic agents induce apoptosis in MCF-7 cells by downregulating the antiapoptotic SK-1 and GCS genes that may result in accumulation of apoptotic ceramides.
22322303 These findings demonstrate a key role for sphingosine kinase-1 in histamine-induced rapid P-selectin up-regulation and associated leukocyte rolling, and suggest that endothelial SK-1 is an important contributor to allergic inflammation
22322056 The expression of SPHK1 in gastric cancer is significantly associated with lymph node metastasis, distant metastasis and a poor prognosis.
22315056 data suggest that decrease in circulating Sphingosine-1-phosphate during prostate cancer progression may stem from a significant downregulation of erythrocyte sphingosine kinase-1 activity which may be a potential mechanism of cancer-induced anaemia.
22227192 These data suggest that SPK1 acetylation plays a key role in cell growth, cell size, and cell-cycle control.
22155656 SphK1 activity is important for insulin synthesis and secretion
22016563 activation of phospholipase C and protein kinase C-beta 2 by the IGF-II/mannose-6-phosphate receptor are required for the activation of sphingosine kinase 1.
21940753 Study has identified SphK1 as a proproliferative oncogenic kinase, an Akt/glycogen synthase kinase-3beta/beta-catenin activator, and probably a biomarker for thyroid cancer as well.
21936950 SPHK1 is implicated in the metastasis of esophageal cancer.
21769916 results showed that in TGW cells, GDNF increased SPHK1 transcription, leading to the production and secretion of S1P
21756066 Data show that nilotinib induces apoptosis through upregulating ceramide synthase genes and downregulating SK-1 in CML cells in addition to inhibition of BCR/ABL.
21696364 [review] SK and the sphingolipid rheostat are important for both islet function and beta cell survival as a common therapeutic target that protects the beta cell from diabetogenic insults and ultimately improves pancreatic islet function.
21672077 over-expression of sphingosine kinase-1 in human endothelial cells promotes, in part, their de-differentiation to a progenitor cell phenotype
21625639 Increased SPHK1 expression is associated with glioma.
21575515 SphK1 potently enhances the prolieration, migration and invasion of colon cancer HT-29 cells, and suppresses cell apoptosis.
21464128 Comparisons with the SK1 inhibitor, SKi or siRNA knockdown of SK1 indicated that (S)-FTY720 vinylphosphonate and FTY720 behave as typical SK1 inhibitors in preventing sphingosine 1-phosphate-stimulated rearrangement of actin in MCF-7 cells.
21418911 SphK1 plays an important role in regulating the MUC5AC expression in airway epithelial cells under the induction of TNF-alpha.
21392092 Melatonin inhibited the stability of HIF-1alpha in a time- and concentration- dependent manners. Also, melatonin decreased SPHK1 activity in PC-3 cells during hypoxia.
21304987 S1P(ext) mediated endothelial cell motility is dependent on intracellular S1P production, which is regulated, in part, by SphK1 and S1P lyase.
21209394 SphK1/S1P signaling may play important roles in head and neck squamous cell carcinoma carcinogenesis
21075214 The PP2A-B'alpha holoenzyme appears to function as an important endogenous regulator of SK1.
21075134 Data suggest that whereas sphingosine kinase localization does not affect downstream metabolism of sphingosine-1-phosphate, localization has an important effect on the pools of substrate to which this key signaling enzyme has access.
20926375 the ubiquitin-proteasomal degradation of SK1 is an important mechanism controlling cell survival
20889557 These results support a model in which the interaction between sphingosine kinase 1, sphingosine 1-phosphate receptors 1 and/or 3, and ERK-1/2 might drive breast cancer progression
20846391 Overexpression of sphingosine kinase 1 is associated with salivary gland carcinoma progression.
20838377 study defines the mechanism regulating eEF1A-mediated SK1 activation, and also establishes SK1 as being integral for PTI-1-induced oncogenesis
20661259 TLR4-mediated SphK1 activation was found to be critical for the redox-dependent activation of HIF-1alpha and ASK1, and the prevention of lipopolysaccharide-induced activation of caspase 3 and the expression interleukin-6.
20634980 Data implicate Sphk-1 in HBD-2 regulation in oral keratinocytes which also involves the activation of PI3K, AKT, GSK-3beta and ERK 1/2.
20606403 results demonstrate that SPHK1 is upregulated in head and neck squamous cell carcinoma and provide clues of the role SPHK1 might play in tumor progression
20520628 conversion of sphingosine to sphingosine-1-phosphate (S1P) protects keratinocytes from UVB-induced cell death
20519401 Overexpression of sphingosine 1-phosphate-producing sphingosine kinase 1 heightened the cells' susceptibility to influenza virus infection.
20404323 Sphingosine kinase mediates resistance to the synthetic retinoid N-(4-hydroxyphenyl)retinamide in human ovarian cancer cells
20386061 Data suggest that the localization of sphingosine kinase 1 influences the substrate pools that it has access to and that S1P can rapidly translocate from the site where it is synthesized to other intracellular sites.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20104488 CXCL4 induces SphK1 enzyme activity as well as its translocation to the cell membrane. SphK1 as a central regulator of acute and delayed monocyte activation
20053797 The effect of isoflurane on caveolae formation in proximal tubule cells via transforming growth factor beta-1 release is reported.
19956567 Sphingosine kinase-1 is central to androgen-regulated prostate cancer growth and survival
19914200 evidence indicates that the COOH-terminal region of SphK1 encompasses a structural element that is necessary for the increase in catalytic activity in response to PMA treatment and that its deletion renders SphK1 active with respect to PMA treatment
19854831 CIB1 interacts with SK1 in a Ca(2+)-dependent manner at the previously identified "calmodulin-binding site" of SK1.
19830907 SphK1 is an important effector of Gq-coupled receptors, linking them via cross-activation of S1P receptors to G(i) and G12/13 signalling pathways.
19815712 Data show that under basal conditions, sphingosine kinase-1, integrin alpha(v)beta(3), and CD31 exist as a heterotrimeric complex which is required in SK-1-mediated endothelial cell survival.
19782042 Direct evidence shows that the plasma membrane lipid raft microdomain is the major site of action for SphK1 to overcome serum-deprived cell growth inhibition.
19706837 Inhibition of SphK1 activity restored the antiproliferative and proapoptotic effects of tamoxifen in TamR cells.
19657322 Transforming growth factor-beta2 upregulates sphingosine kinase-1 activity, which in turn attenuates the fibrotic response to TGF-beta2 by impeding CTGF expression.
19633297 IGFBP-3 in MCF-10A cells requires SphK1 activity and S1P1/S1P3, suggesting that S1P, the product of SphK activity and ligand for S1P1 and S1P3
19240026 Results indicate that SPHK1 and 2 isoforms and neutral sphingomyelinase contribute to the regulation of chemosensitivity by controlling ceramide formation and the downstream Akt pathway in human colon cancer cells.
19238330 The sphingosine kinase 1 signaling pathway is activated in Rheumatoid Arthritis, suggesting that manipulation of sphingosine kinase 1 activity in diseases of aberrant inflammation and angiogenesis may be beneficial.
19162217 SPHK1 inhibition is a novel way to block PAR-1 mediated signalling.
19116345 Evidence suggesting that SPHK enhances migration of ML-1 cells by an autocrine mechanism and that the S1P-evoked migration is dependent on protein kinase C alpha, ERK1/2, and SPHK.
19074142 SphK1 expression is transcriptionally regulated by IL-1 in glioblastoma cells, and this pathway may be important in regulating survival and invasiveness of glioblastoma cells.
19017993 Anti-inflammatory effects of sphingosine kinase modulation in inflammatory arthritis
18980995 SPHK1 in astrocytoma cell lines was elevated at both mRNA and protein levels, and the SPHK1 mRNA and protein were significantly up-regulated by up to 6.8- and 40-fold, respectively, in primary astrocytomas
18922940 Sphingosine kinase 1 is a new modulator of hypoxia inducible factor 1alpha during hypoxia in human cancer cells.
18852266 PP2A appears to function as an endogenous regulator of SK1 phosphorylation
18849324 the crucial role of activation of the SPHK1S1PS1P1 signaling pathway in response to inflammatory mediators in endothelial cells in regulating endothelial barrier homeostasis.
18824518 SphK1/sphingosine-1-phosphate pathway contributes to colon carcinogenesis
18718048 Chronic myelogenous leukemia cells express SphK-1 and different S1P receptor, and P210(bcr/abl) fusion protein in CML cells can activate SphK-1.
18644866 Datas suggest that filamin A links sphingosine kinase 1 and sphingosine-1-phosphate receptor 1 to locally influence the dynamics of actin cytoskeletal structures at lamellipodia to promote cell movement.
18426913 Sphingosine kinases and sphingosine-1-phosphate are critical for transforming growth factor beta-induced ERK1 and ERK2 activation and promotion of migration and invasion of esophageal cancer cells
18401414 SphK1 is inolved in regulating imatinib-induced apoptosis and SphK1 is a downstream effector of the Bcr-Abl/Ras/ERK pathway inhibited by imatinib but upstream regulator of Bcl-2 family members
18362204 apoptotic cells may up-regulate SphK1 to produce and secrete sphingosine-1-phosphate that serves as a "come-and-get-me" signal for scavenger cells to engulf them in order to prevent necrosis
18263879 a novel mechanism of regulation of both SK1 and SK2 that is mediated by their interaction with eEF1A.
18261991 The hypoxia-stimulated SK-1 upregulation was functionally coupled to increased migration since the selective depletion of SK-1, but not of SK-2, by siRNAs abolished the migratory response.
18199826 Ang-1-induced inhibition of leakiness is mediated through activation of SK-1, defining a new signaling pathway in the Ang-1 regulation of permeability.
18192241 Activation of sphingosine kinase-1 mediates induction of endothelial cell proliferation and angiogenesis by epoxyeicosatrienoic acids.
18178871 These data suggest that differential formation of sphingosine-1-phosphate by SphK1 and SphK2 has distinct and important actions in human mast cells.
18058224 High expression of sphingosine kinase 1 is associated with estrogen receptor negative breast breast cancer.
17822721 the SKase pathway, through the generation of S1P, is critically involved in mediating globular adiponectin-induced endothelial cell activation
17641298 These data suggested that SPHK1 activation by TGF-beta1 leads to Rho-associated myofibroblasts differentiation mediated by transactivated S1P receptors in the lung fibrogenic process.
17599053 BCR/ABL induces SPK1 expression and increases its cellular activity, leading to upregulation of Mcl-1 in CML cells.
17519232 the localization and activity of SK1 are coordinately regulated with actin dynamics during macrophage activation
17482291 the PI3K/AKT/mTOR signaling pathway is involved in regulation of SphK1, with AKT2 playing a key role in PDGF-induced SphK1 expression
17388800 IGFBP-3 induces angiogenesis through IGF-I- and SphK1-dependent mechanisms
17114809 SphK-dependent Akt activation plays a significant role in TNF-alpha-induced cyclin D expression and cell proliferation
17064696 SK1 is cleaved by cathepsin B in a sequential manner after basic amino acids, and the initial cleavages at the two identified sites, histidine 122 and arginine 199, occur independently of each other.
16623665 results suggest that export of Sphk-1a isoform occurs under physiological conditions and may contribute to the establishment of the vascular S1P gradient.
16571380 Data show that protein kinase C-alpha activation in endothelial cells leads to upregulation of sphingosine kinase-1 expression and activity, which is critically involved in the mechanism of endothelial cell migration.
16529909 These findings uncover a new functional role for Sphingosine kinase 1 (SK1), which can control survival/death balance by targeting sphingolipid de novo biosynthesis.
16516161 These findings strongly suggest that high expression and up-regulation of SPHK1 and S1P receptors protect PC3 cells from the apoptosis induced by CPT.
16507765 For the first time endogenous SK1 is implicated as an important survival enzyme in MCF-7 cells. The biological consequences of knocking down the enzyme are linked to its biochemical role as a regulator of sphingolipid metabolism.
16243846 the specific plasma membrane localization and activation of SK1 is mediated largely by specific lipid-protein interactions
16194537 results suggest that SphK1 may be critical for growth, metastasis and chemoresistance of human breast cancers
16038795 Findings demonstrate a role of SPHK1 activation in proinflammatory signalling and of SPHK1 basal activity in survival of A549 lung carcinoma cells.
15855330 IL-1beta and TNF-alpha induced an early and sustained increase in SPHK activity in INS-1 cells and isolated islets.
15749892 model in which M.tuberc. inhibits both the activation and phagosomal translocation of sphingosine kinase 1 to block the localized Ca2+ transients required for phagosome maturation
15710602 SK1 down-regulation by TNF is dependent on the lysosomal pathway of apoptosis and specifically on cathepsin B, which functions as an SK1 protease in cells
15693752 SK1 has marked effects on cell function, with plasma membrane-associated SK having a potent inhibitory effect on the G1-S phase transition [SK1]
15632208 role for SK in the regulation of vascular phenomena that occur under conditions of stress
15585953 Comparison of base sequence of SPHK1/Sphk1 in human, mouse, and rat.
15302883 SPHK plays an important role in the immune-inflammatory pathologies triggered by anaphylatoxins in human neutrophils
15265705 PI3K and ERK/MAPK mediated the activation of sphingosine kinase and would be involved in the HGF-induced migration of endothelial cells.
15191888 SphK1 mediates TNF-alpha-induced MCP-1 gene expression through a p38 MAPK-dependent pathway and may participate in oscillatory flow-mediated proinflammatory signaling pathway in the vasculature.
15052627 hereditary neuralgic amyotrophy is not caused by point mutations of sphingosine kinase 1
14988393 SK1 is down-regulated by genotoxic stress, and basal SK1 function may be necessary for the maintenance of tumor cell growth
14742298 Data show that respiratory syncytial virus stimulates sphingosine kinase activity in lung epithelial cells, leading to activation of antiapoptotic sphingosine 1-phosphate and subsequently activation of Akt and extracellular signal-related kinase.
14575709 results provide the first evidence of the active nuclear export of SPHK1 and suggest it is mediated by a CRM1-dependent pathway
14532121 Activation of this enzyme in mediated by ERK1/2 phoshporylation
12847068 Resting tone and myogenic responses of isolated hamster resistance arteries increased with forced expression of human Sphk1 in smooth muscle cells
12444147 role for sphingosine kinase in the regulation of neutrophil priming
12393916 characterization of the nucleotide-binding site of human sphingosine kinase 1 through a combination of site-directed mutagenesis and affinity labeling with the ATP analogue, FSBA
12124383 activation and translocation to cell membrane dependent on protein kinase C
12080051 results indicate that SPHK1-interacting protein(SKIP) is a novel protein likely to play a regulatory role in the modulation of SPHK1 activity
11915350 synthesize sphingosine 1-phosphate,a lipid mediator in intracellular signaling system
11777919 These findings show a role for SphK in the signal transduction by TRAF2 specifically leading to activation of NF-kappa B and antiapoptosis.

AA Sequence

MDPAGGPRGVLPRPCRVLVLLNPRGGKGKALQLFRSHVQPLLAEAEISFTLMLTERRNHARELVRSEELG      1 - 70
RWDALVVMSGDGLMHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASLNHYAGYEQVTNEDLLTNCTL     71 - 140
LLCRRLLSPMNLLSLHTASGLRLFSVLSLAWGFIADVDLESEKYRRLGEMRFTLGTFLRLAALRTYRGRL    141 - 210
AYLPVGRVGSKTPASPVVVQQGPVDAHLVPLEEPVPSHWTVVPDEDFVLVLALLHSHLGSEMFAAPMGRC    211 - 280
AAGVMHLFYVRAGVSRAMLLRLFLAMEKGRHMEYECPYLVYVPVVAFRLEPKDGKGVFAVDGELMVSEAV    281 - 350
QGQVHPNYFWMVSGCVEPPPSWKPQQMPPPEEPL                                        351 - 384
//

Text Mined References (191)

PMID Year Title
26886371 2016 Increased mRNA Levels of Sphingosine Kinases and S1P Lyase and Reduced Levels of S1P Were Observed in Hepatocellular Carcinoma in Association with Poorer Differentiation and Earlier Recurrence.
26842184 Role of Sphk1 in the malignant transformation of breast epithelial cells and breast cancer progression.
26716409 2016 Sphingosine kinase 1 is required for TGF-? mediated fibroblastto- myofibroblast differentiation in ovarian cancer.
26590717 2015 LncRNA Khps1 Regulates Expression of the Proto-oncogene SPHK1 via Triplex-Mediated Changes in Chromatin Structure.
26549227 2015 MiR-506 suppresses liver cancer angiogenesis through targeting sphingosine kinase 1 (SPHK1) mRNA.
26540633 2016 Long non-coding RNA HULC promotes tumor angiogenesis in liver cancer by up-regulating sphingosine kinase 1 (SPHK1).
26493335 2015 Regulation of cellular sphingosine-1-phosphate by sphingosine kinase 1 and sphingosine-1-phopshate lyase determines chemotherapy resistance in gastroesophageal cancer.
26376826 2016 Transforming growth factor-?-sphingosine kinase 1/S1P signaling upregulates microRNA-21 to promote fibrosis in renal tubular epithelial cells.
26311741 2015 Sphingosine kinase 1 is a reliable prognostic factor and a novel therapeutic target for uterine cervical cancer.
26264277 2015 Sphingosine Kinase-1 Protects Multiple Myeloma from Apoptosis Driven by Cancer-Specific Inhibition of RTKs.
26073327 2015 Hepatitis B virus X protein promotes human hepatoma cell growth via upregulation of transcription factor AP2? and sphingosine kinase 1.
26071354 2015 MicroRNA-101 down-regulates sphingosine kinase 1 in colorectal cancer cells.
26045781 2015 Resveratrol induces apoptosis of leukemia cell line K562 by modulation of sphingosine kinase-1 pathway.
25892494 2015 A novel chimeric aequorin fused with caveolin-1 reveals a sphingosine kinase 1-regulated Ca²? microdomain in the caveolar compartment.
25805832 2015 A novel role of sphingosine kinase-1 in the invasion and angiogenesis of VHL mutant clear cell renal cell carcinoma.
25786072 2015 Analysis of sphingosine kinase activity in single natural killer cells from peripheral blood.
25778867 2015 High expression of sphingosine kinase 1 is associated with poor prognosis in nasopharyngeal carcinoma.
25671829 The impact of sphingosine kinase 1 on the prognosis of hepatocellular carcinoma patients with portal vein tumor thrombus.
25587035 2015 Elevated adenosine signaling via adenosine A2B receptor induces normal and sickle erythrocyte sphingosine kinase 1 activity.
25537088 2015 SPHK1 inhibitor suppresses cell proliferation and invasion associated with the inhibition of NF-?B pathway in hepatocellular carcinoma.
25481644 2015 Sphingosine kinase 1 contributes to leptin-induced STAT3 phosphorylation through IL-6/gp130 transactivation in oestrogen receptor-negative breast cancer.
25417698 2014 Pathological roles of the VEGF/SphK pathway in Niemann-Pick type C neurons.
25411162 2015 A novel E2F/sphingosine kinase 1 axis regulates anthracycline response in squamous cell carcinoma.
25404266 2014 [Role of SPHK1 regulates multi-drug resistance of small cell lung cancer ?and its clinical significance].
25319495 2015 Regulation of de novo sphingolipid biosynthesis by the ORMDL proteins and sphingosine kinase-1.
25310737 2014 The key role of sphingosine kinases in the molecular mechanism of neuronal cell survival and death in an experimental model of Parkinson's disease.
25260803 2014 High expression of SPHK1 in sacral chordoma and association with patients' poor prognosis.
25176316 2015 Oxidized LDL-induced angiogenesis involves sphingosine 1-phosphate: prevention by anti-S1P antibody.
25109605 2014 SphK1 confers resistance to apoptosis in gastric cancer cells by downregulating Bim via stimulating Akt/FoxO3a signaling.
24903384 2014 The role of sphingosine kinase isoforms and receptors S1P1, S1P2, S1P3, and S1P5 in primary, secondary, and recurrent glioblastomas.
24816639 2014 Knockdown of sphingosine kinase 1 inhibits the migration and invasion of human rheumatoid arthritis fibroblast-like synoviocytes by down-regulating the PI3K/AKT activation and MMP-2/9 production in vitro.
24503067 2014 Sphingosine kinase 1 regulates measles virus replication.
24473437 2014 Sphingosine kinase 1 regulates adipose proinflammatory responses and insulin resistance.
24468113 2014 Reduced sphingosine kinase-1 and enhanced sphingosine 1-phosphate lyase expression demonstrate deregulated sphingosine 1-phosphate signaling in Alzheimer's disease.
24452756 2014 Sphingosine kinases/sphingosine-1-phosphate and death Signalling in APP-transfected cells.
24422628 2014 Sphingosine kinase (SphK) 1 and SphK2 play equivalent roles in mediating insulin's mitogenic action.
24337110 2014 Inhibition of insulin-like growth factor-binding protein-3 signaling through sphingosine kinase-1 sensitizes triple-negative breast cancer cells to EGF receptor blockade.
24276247 2014 Enhanced expression of transferrin receptor 1 contributes to oncogenic signalling by sphingosine kinase 1.
24137500 2013 Sphingosine kinase 1 serves as a pro-viral factor by regulating viral RNA synthesis and nuclear export of viral ribonucleoprotein complex upon influenza virus infection.
24092575 2014 Increased SPHK1 expression is associated with poor prognosis in bladder cancer.
23955546 2013 Predictive value of sphingosine kinase 1 expression in neoadjuvant treatment of breast cancer.
23939980 2013 Reduced sphingosine kinase 1 activity in dengue virus type-2 infected cells can be mediated by the 3' untranslated region of dengue virus type-2 RNA.
23928990 2013 Downregulation of microRNA-515-5p by the estrogen receptor modulates sphingosine kinase 1 and breast cancer cell proliferation.
23893239 2014 Dual role of sphingosine kinase-1 in promoting the differentiation of dermal fibroblasts and the dissemination of melanoma cells.
23861887 2013 Sphingosine kinase activity is not required for tumor cell viability.
23839903 2013 Hepatopoietin Cn reduces ethanol-induced hepatoxicity via sphingosine kinase 1 and sphingosine 1-phosphate receptors.
23658376 2013 Factor-Xa-induced mitogenesis and migration require sphingosine kinase activity and S1P formation in human vascular smooth muscle cells.
23651497 2013 A signaling cascade mediated by ceramide, src and PDGFR? coordinates the activation of the redox-sensitive neutral sphingomyelinase-2 and sphingosine kinase-1.
23602659 2013 Molecular basis of sphingosine kinase 1 substrate recognition and catalysis.
23576579 2013 Sphingosine kinase 1 overexpression stimulates intestinal epithelial cell proliferation through increased c-Myc translation.
23466305 2013 Sphingosine kinase/sphingosine 1-phosphate (S1P)/S1P receptor axis is involved in liver fibrosis-associated angiogenesis.
23462226 2013 Increased expression of sphingosine kinase in the amnion during labor.
23426175 2013 Sphingosine kinase 1 plays a role in the upregulation of CD44 expression through extracellular signal-regulated kinase signaling in human colon cancer cells.
23359503 2013 Usage of sphingosine kinase isoforms in mast cells is species and/or cell type determined.
23314175 2013 The roles of sphingosine kinases 1 and 2 in regulating the Warburg effect in prostate cancer cells.
23232649 2013 Sphingosine kinase 1 promotes tumor progression and confers malignancy phenotypes of colon cancer by regulating the focal adhesion kinase pathway and adhesion molecules.
23166225 2013 Sphingosine kinase 1 overexpression contributes to cetuximab resistance in human colorectal cancer models.
23106337 2013 Sphingosine 1-phosphate induces filopodia formation through S1PR2 activation of ERM proteins.
22961081 2012 Overexpression of sphingosine kinase 1 prevents ceramide accumulation and ameliorates muscle insulin resistance in high-fat diet-fed mice.
22833671 2012 Oncogenic K-Ras regulates bioactive sphingolipids in a sphingosine kinase 1-dependent manner.
22781898 2012 [The expression and clinical significance of SphK1 and nuclear factor-?B p65 in human colon carcinoma].
22733311 2013 Identification of novel functional and spatial associations between sphingosine kinase 1, sphingosine 1-phosphate receptors and other signaling proteins that affect prognostic outcome in estrogen receptor-positive breast cancer.
22684547 2012 Sphingosine kinase 1 enhances colon cancer cell proliferation and invasion by upregulating the production of MMP-2/9 and uPA via MAPK pathways.
22460268 2012 Expression of sphingosine 1-phosphate receptor 4 and sphingosine kinase 1 is associated with outcome in oestrogen receptor-negative breast cancer.
22450659 2012 miR-124 inhibits cell proliferation in gastric cancer through down-regulation of SPHK1.
22422617 2012 Low-density lipoprotein induced expression of connective tissue growth factor via transactivation of sphingosine 1-phosphate receptors in mesangial cells.
22331716 The roles of antiapoptotic sphingosine kinase-1 and glucosylceramide genes in drug induced cell death of MCF-7 breast cancer cells.
22322303 2012 Rapid histamine-induced neutrophil recruitment is sphingosine kinase-1 dependent.
22322056 2011 [Relationship between sphingosine kinase 1 expression and tumor invasion, metastasis and prognosis in gastric cancer].
22315056 2012 Circulating sphingosine-1-phosphate and erythrocyte sphingosine kinase-1 activity as novel biomarkers for early prostate cancer detection.
22227192 2012 Acetylation of sphingosine kinase 1 regulates cell growth and cell-cycle progression.
22155656 2012 Sphingosine kinase 1 knockdown reduces insulin synthesis and secretion in a rat insulinoma cell line.
22016563 2011 Phospholipase C and protein kinase C-? 2 mediate insulin-like growth factor II-dependent sphingosine kinase 1 activation.
21940753 2011 Sphingosine kinase 1 is overexpressed and promotes proliferation in human thyroid cancer.
21936950 2011 An novel role of sphingosine kinase-1 (SPHK1) in the invasion and metastasis of esophageal carcinoma.
21769916 2011 Sphingosine kinase 1/S1P pathway involvement in the GDNF-induced GAP43 transcription.
21756066 2011 Roles of ceramide synthase and ceramide clearence genes in nilotinib-induced cell death in chronic myeloid leukemia cells.
21696364 2011 The sphingolipid rheostat: a potential target for improving pancreatic islet survival and function.
21672077 2011 Over-expression of sphingosine kinase-1 enhances a progenitor phenotype in human endothelial cells.
21625639 2011 Sphingosine kinase 1 regulates the Akt/FOXO3a/Bim pathway and contributes to apoptosis resistance in glioma cells.
21575515 2011 [Effect of sphingosine kinase 1 on the apoptosis, migration and invasion of colon cancer HT-29 cells and its molecular mechanisms].
21464128 2011 FTY720 analogues as sphingosine kinase 1 inhibitors: enzyme inhibition kinetics, allosterism, proteasomal degradation, and actin rearrangement in MCF-7 breast cancer cells.
21418911 2011 [Regulation of sphingosine kinase 1 in the TNF-?-induced expression of MUC5AC in airway epithelial cells].
21392092 2011 Sphingosine kinase 1 pathway is involved in melatonin-induced HIF-1? inactivation in hypoxic PC-3 prostate cancer cells.
21304987 2011 Intracellular S1P generation is essential for S1P-induced motility of human lung endothelial cells: role of sphingosine kinase 1 and S1P lyase.
21209394 2011 A role of sphingosine kinase 1 in head and neck carcinogenesis.
21075214 2011 A critical role for the protein phosphatase 2A B'? regulatory subunit in dephosphorylation of sphingosine kinase 1.
21075134 2011 Sphingosine kinase localization in the control of sphingolipid metabolism.
20926375 2010 The sphingosine kinase 1 inhibitor 2-(p-hydroxyanilino)-4-(p-chlorophenyl)thiazole induces proteasomal degradation of sphingosine kinase 1 in mammalian cells.
20889557 2010 High expression of sphingosine 1-phosphate receptors, S1P1 and S1P3, sphingosine kinase 1, and extracellular signal-regulated kinase-1/2 is associated with development of tamoxifen resistance in estrogen receptor-positive breast cancer patients.
20846391 2010 Overexpression of sphingosine kinase 1 is associated with salivary gland carcinoma progression and might be a novel predictive marker for adjuvant therapy.
20838377 2011 Guanine nucleotides regulate sphingosine kinase 1 activation by eukaryotic elongation factor 1A and provide a mechanism for eEF1A-associated oncogenesis.
20661259 2011 The involvement of sphingosine kinase 1 in LPS-induced Toll-like receptor 4-mediated accumulation of HIF-1? protein, activation of ASK1 and production of the pro-inflammatory cytokine IL-6.
20634980 2010 Sphingosine kinase-1 is required for toll mediated beta-defensin 2 induction in human oral keratinocytes.
20606403 2010 The expression of sphingosine kinase-1 in head and neck carcinoma.
20577214 2010 Sphingosine-1-phosphate is a missing cofactor for the E3 ubiquitin ligase TRAF2.
20520628 2010 Hydrolytic pathway protects against ceramide-induced apoptosis in keratinocytes exposed to UVB.
20519401 2010 Sphingosine 1-phosphate-metabolizing enzymes control influenza virus propagation and viral cytopathogenicity.
20404323 2010 Sphingosine kinase mediates resistance to the synthetic retinoid N-(4-hydroxyphenyl)retinamide in human ovarian cancer cells.
20386061 2010 Intracellular localization of sphingosine kinase 1 alters access to substrate pools but does not affect the degradative fate of sphingosine-1-phosphate.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20104488 2010 CXCL4-induced monocyte survival, cytokine expression, and oxygen radical formation is regulated by sphingosine kinase 1.
20053797 2010 Isoflurane via TGF-beta1 release increases caveolae formation and organizes sphingosine kinase signaling in renal proximal tubules.
19956567 2009 Sphingosine kinase-1 is central to androgen-regulated prostate cancer growth and survival.
19914200 2010 Enhancement of sphingosine kinase 1 catalytic activity by deletion of 21 amino acids from the COOH-terminus.
19854831 2010 Translocation of sphingosine kinase 1 to the plasma membrane is mediated by calcium- and integrin-binding protein 1.
19830907 2009 Galpha(q)-mediated plasma membrane translocation of sphingosine kinase-1 and cross-activation of S1P receptors.
19815712 2009 Sphingosine kinase-1 associates with integrin {alpha}V{beta}3 to mediate endothelial cell survival.
19782042 2009 Sphingosine kinase 1 localized to the plasma membrane lipid raft microdomain overcomes serum deprivation induced growth inhibition.
19706837 2009 Restoring endocrine response in breast cancer cells by inhibition of the sphingosine kinase-1 signaling pathway.
19657322 2009 Transforming growth factor-beta2 upregulates sphingosine kinase-1 activity, which in turn attenuates the fibrotic response to TGF-beta2 by impeding CTGF expression.
19633297 2009 Potentiation of growth factor signaling by insulin-like growth factor-binding protein-3 in breast epithelial cells requires sphingosine kinase activity.
19240026 2009 Sphingosine kinase isoforms regulate oxaliplatin sensitivity of human colon cancer cells through ceramide accumulation and Akt activation.
19238330 2009 Chronic increases in sphingosine kinase-1 activity induce a pro-inflammatory, pro-angiogenic phenotype in endothelial cells.
19162217 2009 Sphingosine kinase 1 is essential for proteinase-activated receptor-1 signalling in epithelial and endothelial cells.
19116345 2009 Sphingosine kinase as an oncogene: autocrine sphingosine 1-phosphate modulates ML-1 thyroid carcinoma cell migration by a mechanism dependent on protein kinase C-alpha and ERK1/2.
19074142 2009 Interleukin-1 regulates the expression of sphingosine kinase 1 in glioblastoma cells.
19017993 2008 Anti-inflammatory effects of sphingosine kinase modulation in inflammatory arthritis.
18980995 2008 Clinical significance of sphingosine kinase-1 expression in human astrocytomas progression and overall patient survival.
18922940 2008 Sphingosine kinase 1: a new modulator of hypoxia inducible factor 1alpha during hypoxia in human cancer cells.
18852266 2008 Deactivation of sphingosine kinase 1 by protein phosphatase 2A.
18849324 2008 Activation of sphingosine kinase-1 reverses the increase in lung vascular permeability through sphingosine-1-phosphate receptor signaling in endothelial cells.
18824518 2009 Role for sphingosine kinase 1 in colon carcinogenesis.
18775504 2009 The CCT/TRiC chaperonin is required for maturation of sphingosine kinase 1.
18718048 2008 [SphK-1/S1P signal pathway in CML cells].
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18644866 2008 Filamin A links sphingosine kinase 1 and sphingosine-1-phosphate receptor 1 at lamellipodia to orchestrate cell migration.
18426913 2008 Sphingosine kinases and sphingosine-1-phosphate are critical for transforming growth factor beta-induced extracellular signal-regulated kinase 1 and 2 activation and promotion of migration and invasion of esophageal cancer cells.
18401414 2008 Sphingosine kinase-1 is a downstream regulator of imatinib-induced apoptosis in chronic myeloid leukemia cells.
18362204 2008 Apoptosis induces expression of sphingosine kinase 1 to release sphingosine-1-phosphate as a "come-and-get-me" signal.
18263879 2008 Eukaryotic elongation factor 1A interacts with sphingosine kinase and directly enhances its catalytic activity.
18261991 2008 Sphingosine kinase-1 is a hypoxia-regulated gene that stimulates migration of human endothelial cells.
18199826 2008 Basal and angiopoietin-1-mediated endothelial permeability is regulated by sphingosine kinase-1.
18192241 2008 Activation of sphingosine kinase-1 mediates induction of endothelial cell proliferation and angiogenesis by epoxyeicosatrienoic acids.
18178871 2008 Distinct roles of sphingosine kinases 1 and 2 in human mast-cell functions.
18058224 2008 Microarray analysis of altered sphingolipid metabolism reveals prognostic significance of sphingosine kinase 1 in breast cancer.
17822721 2007 Globular adiponectin induces adhesion molecule expression through the sphingosine kinase pathway in vascular endothelial cells.
17641298 2007 Sphingosine kinase 1 regulates differentiation of human and mouse lung fibroblasts mediated by TGF-beta1.
17599053 2007 Sphingosine kinase-1 mediates BCR/ABL-induced upregulation of Mcl-1 in chronic myeloid leukemia cells.
17519232 2007 The localization and activity of sphingosine kinase 1 are coordinately regulated with actin cytoskeletal dynamics in macrophages.
17482291 2007 Sphingosine kinase 1 expression is regulated by signaling through PI3K, AKT2, and mTOR in human coronary artery smooth muscle cells.
17388800 2007 Insulin-like growth factor binding protein-3 induces angiogenesis through IGF-I- and SphK1-dependent mechanisms.
17124500 2006 Sphingosine 1-phosphate as a regulator of osteoclast differentiation and osteoclast-osteoblast coupling.
17114809 2007 Tumor necrosis factor-alpha-stimulated cell proliferation is mediated through sphingosine kinase-dependent Akt activation and cyclin D expression.
17064696 2006 Sphingosine kinase-1 is cleaved by cathepsin B in vitro: identification of the initial cleavage sites for the protease.
16888242 2006 FHL2/SLIM3 decreases cardiomyocyte survival by inhibitory interaction with sphingosine kinase-1.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16623665 2006 Extracellular export of sphingosine kinase-1a contributes to the vascular S1P gradient.
16571380 2006 Histamine increases sphingosine kinase-1 expression and activity in the human arterial endothelial cell line EA.hy 926 by a PKC-alpha-dependent mechanism.
16529909 2006 De novo biosynthesis of dihydrosphingosine-1-phosphate by sphingosine kinase 1 in mammalian cells.
16516161 2006 High expression of sphingosine kinase 1 and S1P receptors in chemotherapy-resistant prostate cancer PC3 cells and their camptothecin-induced up-regulation.
16507765 2006 Loss of sphingosine kinase-1 activates the intrinsic pathway of programmed cell death: modulation of sphingolipid levels and the induction of apoptosis.
16316995 2006 IgE-dependent activation of sphingosine kinases 1 and 2 and secretion of sphingosine 1-phosphate requires Fyn kinase and contributes to mast cell responses.
16243846 2005 The mechanism of membrane targeting of human sphingosine kinase 1.
16194537 2005 Sphingosine kinase 1 is required for migration, proliferation and survival of MCF-7 human breast cancer cells.
16038795 2005 Basal and induced sphingosine kinase 1 activity in A549 carcinoma cells: function in cell survival and IL-1beta and TNF-alpha induced production of inflammatory mediators.
15855330 2005 Sphingosine kinase activity and sphingosine-1 phosphate production in rat pancreatic islets and INS-1 cells: response to cytokines.
15749892 2005 Sphingosine kinase 1 (SK1) is recruited to nascent phagosomes in human macrophages: inhibition of SK1 translocation by Mycobacterium tuberculosis.
15710602 2005 Tumor necrosis factor induces the loss of sphingosine kinase-1 by a cathepsin B-dependent mechanism.
15693752 2005 Effect of a membrane-targeted sphingosine kinase 1 on cell proliferation and survival.
15632208 2005 Sphingosine kinase-1 enhances endothelial cell survival through a PECAM-1-dependent activation of PI-3K/Akt and regulation of Bcl-2 family members.
15623571 2005 Phosphorylation-dependent translocation of sphingosine kinase to the plasma membrane drives its oncogenic signalling.
15585953 2004 Identification of genetic and epigenetic similarities of SPHK1/Sphk1 in mammals.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15302883 2004 Anaphylatoxin signaling in human neutrophils. A key role for sphingosine kinase.
15265705 2004 Sphingosine kinase activation regulates hepatocyte growth factor induced migration of endothelial cells.
15191888 2004 Sphingosine kinase-1 mediates TNF-alpha-induced MCP-1 gene expression in endothelial cells: upregulation by oscillatory flow.
15052627 2004 Genomic organization and mutation analysis of three candidate genes for hereditary neuralgic amyotrophy.
14988393 2004 Down-regulation of sphingosine kinase-1 by DNA damage: dependence on proteases and p53.
14742298 2004 Sphingosine kinase mediates activation of extracellular signal-related kinase and Akt by respiratory syncytial virus.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14575709 2003 Identification of functional nuclear export sequences in human sphingosine kinase 1.
14532121 2003 Activation of sphingosine kinase 1 by ERK1/2-mediated phosphorylation.
12847068 2003 Sphingosine kinase modulates microvascular tone and myogenic responses through activation of RhoA/Rho kinase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12444147 2002 Sphingosine kinase: a point of convergence in the action of diverse neutrophil priming agents.
12441135 2002 Sphingosine kinase type 1 promotes estrogen-dependent tumorigenesis of breast cancer MCF-7 cells.
12393916 2002 The nucleotide-binding site of human sphingosine kinase 1.
12124383 2002 PKC-dependent activation of sphingosine kinase 1 and translocation to the plasma membrane. Extracellular release of sphingosine-1-phosphate induced by phorbol 12-myristate 13-acetate (PMA).
12080051 2002 Cloning and characterization of a protein kinase A anchoring protein (AKAP)-related protein that interacts with and regulates sphingosine kinase 1 activity.
12077123 2002 Identification and characterization of RPK118, a novel sphingosine kinase-1-binding protein.
11777919 2002 Sphingosine kinase interacts with TRAF2 and dissects tumor necrosis factor-alpha signaling.
10947957 2000 Human sphingosine kinase: purification, molecular cloning and characterization of the native and recombinant enzymes.
10863092 2000 Human sphingosine kinase: molecular cloning, functional characterization and tissue distribution.
10802064 2000 Functional characterization of human sphingosine kinase-1.
10751414 2000 Molecular cloning and functional characterization of a novel mammalian sphingosine kinase type 2 isoform.
9726979 1998 Molecular cloning and functional characterization of murine sphingosine kinase.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7698749 1994 2058 expressed sequence tags (ESTs) from a human fetal lung cDNA library.