Property Summary

Ligand Count 24
NCBI Gene PubMed Count 211
PubMed Score 583.62
PubTator Score 400.59

Knowledge Summary

Patent (18,734)


  Differential Expression (10)

Disease log2 FC p
cystic fibrosis 1.200 3.9e-04
ependymoma 1.100 1.8e-05
glioblastoma 1.100 6.9e-05
intraductal papillary-mucinous adenoma (... -1.200 3.0e-04
osteosarcoma 1.518 9.8e-03
ovarian cancer 1.100 2.3e-02
pediatric high grade glioma 1.400 2.9e-04
psoriasis 1.900 7.6e-05
sonic hedgehog group medulloblastoma 2.200 3.9e-04
tuberculosis -2.300 5.7e-07

Protein-protein Interaction (3)

Gene RIF (192)

AA Sequence

QGQVHPNYFWMVSGCVEPPPSWKPQQMPPPEEPL                                        351 - 384

Text Mined References (214)

PMID Year Title