Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0CW21
Symbols SPG20OS
C13orf43
SPG20-AS1

 Compartment GO Term (0)

AA Sequence

MKDIGHLQHLAQRLQWNRRAVNICGMHGWTKDLSPHSRMPSMLEHVKHYMSC                        1 - 52
//

Text Mined References (2)

PMID Year Title