Property Summary

NCBI Gene PubMed Count 11
PubMed Score 21.20
PubTator Score 8.34

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
25825516 hSpindly is farnesylated in vivo and farnesylation is essential for its interaction with the RZZ complex and hence Kinetochore localization.
25808490 Farnesylation of Spindly is essential for its localization, & thus for proper localization of dynein & dynactin, to prometaphase kinetochores. Both Spindly and CENP-E farnesylation are required for efficient chromosome congression
20439434 dynein-mediated removal of Spindly from microtubule-attached kinetochores, rather than poleward transport per se, is the critical reaction in checkpoint silencing
20427577 Spindly is not only required for kinetochore localization of dynein but is a functional component of a mechanism that couples dynein-dependent poleward movement of chromosomes to their efficient attachment to microtubules.
19468067 [hSpindly] Localization of human Spindly (hSpindly) to kinetochores is controlled by the Rod/Zw10/Zwilch (RZZ) complex and Aurora B.

AA Sequence

MEADIITNLRCRLKEAEEERLKAAQYGLQLVESQNELQNQLDKCRNEMMTMTESYEQEKYTLQREVELKS      1 - 70
RMLESLSCECEAIKQQQKMHLEKLEEQLSRSHGQEVNELKTKIEKLKVELDEARLSEKQLKHQVDHQKEL     71 - 140
LSCKSEELRVMSERVQESMSSEMLALQIELTEMESMKTTLKEEVNELQYRQEQLELLITNLMRQVDRLKE    141 - 210
EKEEREKEAVSYYNALEKARVANQDLQVQLDQALQQALDPNSKGNSLFAEVEDRRAAMERQLISMKVKYQ    211 - 280
SLKKQNVFNREQMQRMKLQIATLLQMKGSQTEFEQQERLLAMLEQKNGEIKHLLGEIRNLEKFKNLYDSM    281 - 350
ESKPSVDSGTLEDNTYYTDLLQMKLDNLNKEIESTKGELSIQRMKALFESQRALDIERKLFANERCLQLS    351 - 420
ESENMKLRAKLDELKLKYEPEETVEVPVLKKRREVLPVDITTAKDACVNNSALGGEVYRLPPQKEETQSC    421 - 490
PNSLEDNNLQLEKSVSIYTPVVSLSPHKNLPVDMQLKKEKKCVKLIGVPADAEALSERSGNTPNSPRLAA    491 - 560
ESKLQTEVKEGKETSSKLEKETCKKLHPILYVSSKSTPETQCPQQ                             561 - 605
//

Text Mined References (20)

PMID Year Title
25825516 2015 A novel role of farnesylation in targeting a mitotic checkpoint protein, human Spindly, to kinetochores.
25808490 2015 Preventing farnesylation of the dynein adaptor Spindly contributes to the mitotic defects caused by farnesyltransferase inhibitors.
25416956 2014 A proteome-scale map of the human interactome network.
23382074 2013 A high-confidence interaction map identifies SIRT1 as a mediator of acetylation of USP22 and the SAGA coactivator complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20439434 2010 Removal of Spindly from microtubule-attached kinetochores controls spindle checkpoint silencing in human cells.
20427577 2010 Spindly/CCDC99 is required for efficient chromosome congression and mitotic checkpoint regulation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19468067 2009 Mitotic control of kinetochore-associated dynein and spindle orientation by human Spindly.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17576797 2007 Spindly, a novel protein essential for silencing the spindle assembly checkpoint, recruits dynein to the kinetochore.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.