Property Summary

NCBI Gene PubMed Count 52
PubMed Score 224.58
PubTator Score 66.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (11)

Disease log2 FC p
breast carcinoma 1.600 5.9e-03
ductal carcinoma in situ 1.200 3.1e-03
fibroadenoma 2.100 1.2e-02
intraductal papillary-mucinous adenoma (... 1.400 3.0e-03
intraductal papillary-mucinous carcinoma... 1.700 3.6e-03
invasive ductal carcinoma 1.500 8.8e-05
lung adenocarcinoma 1.200 2.9e-09
ovarian cancer 1.100 1.0e-09
primary Sjogren syndrome -1.200 4.9e-02
psoriasis -1.800 7.3e-22
uncontrolled asthma 1.200 3.0e-03

Protein-protein Interaction (8)

Gene RIF (44)

AA Sequence

MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPED      1 - 70
SSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKL     71 - 140
LNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWK    141 - 210
SAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFK    211 - 280
IEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPI                   281 - 335
//

Text Mined References (53)

PMID Year Title