Property Summary

NCBI Gene PubMed Count 45
PubMed Score 207.28
PubTator Score 66.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
uncontrolled asthma 1.200 3.0e-03
intraductal papillary-mucinous adenoma (... 1.700 4.2e-04
intraductal papillary-mucinous carcinoma... 1.900 3.0e-03
breast carcinoma 1.600 5.9e-03
fibroadenoma 2.100 1.2e-02
lung adenocarcinoma 2.100 9.2e-10
primary Sjogren syndrome -1.200 4.9e-02
ductal carcinoma in situ 2.400 2.0e-03
invasive ductal carcinoma 2.800 6.2e-04
ovarian cancer 1.300 7.2e-06
psoriasis -1.800 7.3e-22

Gene RIF (38)

PMID Text
26965996 PDEF gene expression is associated with the extent of bladder neoplasia and PDEF modulated the expressions of EMT-related genes.
25376946 We found significantly increased SPDEF and MUC5AC expression in CRSwNP patients compared to the controls (P < .05); the mRNA level of SPDEF was positively correlated with MUC5AC expression in CRS patients (P < .05).
25254494 SPDEF inhibits prostate carcinogenesis by disrupting a positive feedback loop in regulation of the Foxm1 oncogene.
24898171 we identified four proteins with different expression in paclitaxel resistant cells, i.e., serpin B3, serpin B4, heat shock protein 27 (all three upregulated) and cytokeratin 18 (downregulated).
24027338 Host Kruppel-like factor 15, Slug, and SPDEF, stimulated the herpes simplex virus type 1 ICP0 promoter more than 150-fold.
23921628 PDEF undergoes DNA methylation in breast cancer cells.
23764000 Prostate-derived ETS factor (PDEF) is identified as a mediator of mammary luminal epithelial lineage-specific gene expression and as a factor required for tumorigenesis in a subset of breast cancers.
23671562 Data indicate that Il-9 and IL-13 regulate expressions of MUC5AC, SPDEF and matrix metalloproteinase 7 (MMP-7) in pediatric bronchial epithelial cell.
23665202 Data demonstrate that SPDEF is required for conjunctival goblet cell differentiation and down-regulation of SPDEF may play a role in human dry eye with goblet cell loss.
23592399 these findings show that PDEF-CEACAM6 is a highly active oncogenic axis in breast cancer
23376423 In colorectal tumors from patients, loss of SPDEF was observed in approximately 85% of tumors and correlated with progression from normal tissue, to adenoma, to adenocarcinoma.
23012424 Data show that SAM pointed domain ETS factor (SPDEF) was induced by rhinoviral infection of primary human airway cells.
22761428 SPDEF functions as a tumor metastasis suppressor in vivo.
22378487 PDEF may inhibit prostate cancer progression by transcriptional downregulation of oncogenic STMN expression.
21764212 Studies indicate that PDEF is a negative regulator of tumor progression and metastasis.
21656828 Up-regulation of PDEF is associated with a favorable prognosis in patients with clinically localized prostate cancer.
21446014 PDEF is a negative regulator of prostate tumor progression and the miR-204-PDEF regulatory axis contributes to PDEF protein loss and resultant cancer progression.
21275604 results show that SPDEF plays a critical role in regulating a transcriptional network mediating IL-13-induced MUC5AC synthesis dependent on STAT6
20550708 studies demonstrate for the first time negative regulation of MMP9 expression by PDEF, and that PDEF expression was lost in aggressive prostate cancer and was inversely associated with MMP9 expression in clinical samples of prostate cancer
20139077 Transcriptional regulation of p21/CIP1 cell cycle inhibitor by PDEF controls cell proliferation and mammary tumor progression
19830706 PDEF is a negative regulator of colon cancer cell growth and migration.
19786015 Spdef was sufficient to inhibit proliferation of intestinal progenitors and induce differentiation into goblet cells.
19505923 we hypothesize that SPDEF has a function in the specification of the progenitor cells of the luminal epithelial lineage that become targets of oncogenesis in luminal breast cancer.
19203193 PDEF may be regulated by Erbb2 or EGFR-activated signaling pathways in breast cancer cells.
18846421 prostate derived Ets factor mRNA quantitation did not reveal any significant differences between breast cancer patients and healthy women
18579687 analysis of PDEF transcriptional networks regulating cell migration during cancer progression
18567002 increased PDEF expression along with reduced survivin was associated with prolonged survival of patients with ovarian cancer
17971898 PDEF mRNA expression could be useful in breast cancer molecular staging.
17521701 these results for the first time show frequent increased expression of PDEF protein in breast and prostate tumors and support a role for PDEF in breast and prostate cancer progression.
17347682 SPDEF was induced following intratracheal allergen exposure and after Th2 cytokine stimulation and was sufficient to cause goblet cell differentiation of Clara cells in vivo.
17197890 prostate-derived Ets factor is a potential marker and target in ovarian cancer
16357167 PDEF overexpression is associated with activation of ErbB2 and CSF-1R and breast tumor progression
16237704 RUNX factors participate in prostate epithelial cell function and cooperate with an Ets transcription factor to regulate PSA gene expression
15882048 Despite common essential features that are shared among Ets members, the crystal structure of PDEF Ets domain demonstrates distinct patterns of interactions at different positions of DNA in achieving sequence specific recognition.
15523673 identified novel protein-protein interaction domains within NKX-3.1 and PDEF that operate in concert with their respective DNA binding domains to mediate functional interactions between these growth regulatory transcription factors
12907642 Pdef loss may alter the expression of genes controlling progression to invasive breast cancer.
12700667 PDEF upregulates p62 promoter activity at 2 sites. PSI downregulates PDEF-induced p62 promoter activation through one of these sites.
11809674 NKX-3.1 interacts with prostate-derived Ets factor and regulates the activity of the PSA promoter.

AA Sequence

MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPED      1 - 70
SSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKL     71 - 140
LNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWK    141 - 210
SAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFK    211 - 280
IEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPI                   281 - 335
//

Text Mined References (46)

PMID Year Title
26965996 2016 Prostate-derived ets factor represses tumorigenesis and modulates epithelial-to-mesenchymal transition in bladder carcinoma cells.
25376946 2015 Enhanced expression of SAM-pointed domain-containing Ets-like factor in chronic rhinosinusitis with nasal polyps.
25254494 2014 SPDEF inhibits prostate carcinogenesis by disrupting a positive feedback loop in regulation of the Foxm1 oncogene.
24898171 2014 HOXB13 regulates the prostate-derived Ets factor: implications for prostate cancer cell invasion.
24027338 2013 Stress-induced cellular transcription factors expressed in trigeminal ganglionic neurons stimulate the herpes simplex virus 1 ICP0 promoter.
23921628 2013 Epigenetic modifications of prostate-derived Ets transcription factor in breast cancer cells.
23764000 2013 PDEF promotes luminal differentiation and acts as a survival factor for ER-positive breast cancer cells.
23671562 2013 Chronic IL9 and IL-13 exposure leads to an altered differentiation of ciliated cells in a well-differentiated paediatric bronchial epithelial cell model.
23665202 2013 Spdef null mice lack conjunctival goblet cells and provide a model of dry eye.
23592399 2013 Prostate derived Ets transcription factor and Carcinoembryonic antigen related cell adhesion molecule 6 constitute a highly active oncogenic axis in breast cancer.
23376423 2013 SPDEF functions as a colorectal tumor suppressor by inhibiting ?-catenin activity.
23012424 2012 SAM-pointed domain ETS factor mediates epithelial cell-intrinsic innate immune signaling during airway mucous metaplasia.
22761428 2012 The transcription factor SPDEF suppresses prostate tumor metastasis.
22378487 2012 PDEF downregulates stathmin expression in prostate cancer.
21764212 2011 Prostate derived ETS factor (PDEF): a putative tumor metastasis suppressor.
21656828 2011 Prostate-derived Ets transcription factor (PDEF) is a potential prognostic marker in patients with prostate cancer.
21446014 2011 Mechanisms and functional consequences of PDEF protein expression loss during prostate cancer progression.
21275604 2010 Interleukin-13 induces mucin 5AC production involving STAT6/SPDEF in human airway epithelial cells.
20550708 2010 Loss of PDEF, a prostate-derived Ets factor is associated with aggressive phenotype of prostate cancer: regulation of MMP 9 by PDEF.
20139077 2010 Transcriptional regulation of p21/CIP1 cell cycle inhibitor by PDEF controls cell proliferation and mammary tumor progression.
19830706 2009 PDEF is a negative regulator of colon cancer cell growth and migration.
19786015 2010 SAM pointed domain ETS factor (SPDEF) regulates terminal differentiation and maturation of intestinal goblet cells.
19505923 2009 Sam-pointed domain containing Ets transcription factor in luminal breast cancer pathogenesis.
19203193 2009 Proteomic analysis of a PDEF Ets transcription factor-interacting protein complex.
18846421 2009 A small subgroup of operable breast cancer patients with poor prognosis identified by quantitative real-time RT-PCR detection of mammaglobin A and trefoil factor 1 mRNA expression in bone marrow.
18579687 2008 Global gene expression analysis identifies PDEF transcriptional networks regulating cell migration during cancer progression.
18567002 2008 Prostate-derived Ets transcription factor as a favorable prognostic marker in ovarian cancer patients.
17971898 2007 Prostate-derived Ets transcription factor overexpression is associated with nodal metastasis and hormone receptor positivity in invasive breast cancer.
17521701 2007 Expression characteristics of prostate-derived Ets factor support a role in breast and prostate cancer progression.
17347682 2007 SPDEF regulates goblet cell hyperplasia in the airway epithelium.
17197890 2007 Prostate-derived Ets factor is overexpressed in serous epithelial ovarian tumors.
16357167 2005 Novel role for PDEF in epithelial cell migration and invasion.
16237704 2006 RUNX1 (AML-1) and RUNX2 (AML-3) cooperate with prostate-derived Ets factor to activate transcription from the PSA upstream regulatory region.
15882048 2005 Analysis of the 2.0 A crystal structure of the protein-DNA complex of the human PDEF Ets domain bound to the prostate specific antigen regulatory site.
15523673 2005 Structural and functional analysis of domains mediating interaction between NKX-3.1 and PDEF.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14719083 2004 Prostate derived Ets transcription factor shows better tumor-association than other cancer-associated molecules.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12907642 2003 Pdef expression in human breast cancer is correlated with invasive potential and altered gene expression.
12700667 2003 p62 overexpression in breast tumors and regulation by prostate-derived Ets factor in breast cancer cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11809674 2002 NKX-3.1 interacts with prostate-derived Ets factor and regulates the activity of the PSA promoter.
10675039 2000 Cloning and expression of the mouse Pse gene encoding a novel Ets family member.
10625666 2000 PDEF, a novel prostate epithelium-specific ets transcription factor, interacts with the androgen receptor and activates prostate-specific antigen gene expression.
6857767 1983 Electron micrographs in five minutes.