Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.96
PubTator Score 13.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.341 6.0e-03
cutaneous lupus erythematosus 1.900 3.2e-03
osteosarcoma -1.472 7.8e-06
pancreatic ductal adenocarcinoma liver m... -2.266 1.1e-03
active Crohn's disease 1.389 3.1e-02
Breast cancer 2.200 2.8e-02
interstitial cystitis 2.300 4.9e-05
non primary Sjogren syndrome sicca 1.100 4.3e-02
psoriasis 1.100 1.4e-24
invasive ductal carcinoma 1.500 1.0e-03
ductal carcinoma in situ 1.300 5.2e-04
ulcerative colitis 1.400 2.0e-06
ovarian cancer 3.100 4.6e-07
pituitary cancer -1.800 1.4e-07

Gene RIF (2)

PMID Text
22190034 HIV-1 gp41 is identified to have a physical interaction with signal peptidase complex subunit 3 homolog (SPCS3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
18187620 Knockdown of signal peptidase complex subunit 3 homolog (SPCS3) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MNTVLSRANSLFAFSLSVMAALTFGCFITTAFKDRSVPVRLHVSRIMLKNVEDFTGPRERSDLGFITFDI      1 - 70
TADLENIFDWNVKQLFLYLSAEYSTKNNALNQVVLWDKIVLRGDNPKLLLKDMKTKYFFFDDGNGLKGNR     71 - 140
NVTLTLSWNVVPNAGILPLVTGSGHVSVPFPDTYEITKSY                                  141 - 180
//

Text Mined References (16)

PMID Year Title
27499293 2016 Inverting the Topology of a Transmembrane Protein by Regulating the Translocation of the First Transmembrane Helix.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24480542 2014 Defective minor spliceosome mRNA processing results in isolated familial growth hormone deficiency.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
8632014 1996 Membrane topology of the 12- and the 25-kDa subunits of the mammalian signal peptidase complex.