Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.42
PubTator Score 16.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Yellow fever 14 3.863 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.651 5.0e-02
Breast cancer 2.500 2.8e-02
ovarian cancer 2.500 2.8e-04
dermatomyositis 1.100 1.2e-03

Synonym

Accession Q9Y6A9 B3KNF8 Q9BVW1
Symbols SPC1
SPC12
HSPC033
YJR010C-A

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (2)

PMID Text
24886551 cis-acting regulatory polymorphisms acting on GNL3 and SPCS1 contribute to the OA association signal at chromosome 3p21, and these genes therefore merit further investigation.
24009510 SPCS1 plays a key role in the formation of the membrane-associated NS2-E2 complex via its interaction with NS2 and E2, which leads to a coordinating interaction between the structural and non-structural proteins

AA Sequence

MLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSCLLTLPPWPIY      1 - 70
RRHPLKWLPVQESSTDDKKPGERKIKRHAKNN                                           71 - 102
//

Text Mined References (15)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24886551 2014 Allelic expression analysis of the osteoarthritis susceptibility locus that maps to chromosome 3p21 reveals cis-acting eQTLs at GNL3 and SPCS1.
24023390 2013 Large-scale top-down proteomics of the human proteome: membrane proteins, mitochondria, and senescence.
24009510 2013 Signal peptidase complex subunit 1 participates in the assembly of hepatitis C virus through an interaction with E2 and NS2.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21269460 2011 Initial characterization of the human central proteome.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
8632014 1996 Membrane topology of the 12- and the 25-kDa subunits of the mammalian signal peptidase complex.