Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.46
PubTator Score 16.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Yellow fever 16 3.851 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer 2.500 2.8e-02
dermatomyositis 1.100 1.2e-03
ovarian cancer -1.600 1.4e-04
pancreatic ductal adenocarcinoma liver m... -1.651 5.0e-02

 GO Function (1)

Gene RIF (2)

AA Sequence

MLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSCLLTLPPWPIY      1 - 70
RRHPLKWLPVQESSTDDKKPGERKIKRHAKNN                                           71 - 102
//

Text Mined References (15)

PMID Year Title