Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.33
PubTator Score 18.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
malignant mesothelioma 2.000 2.0e-07
glioblastoma 2.800 5.2e-06
group 3 medulloblastoma 3.400 9.8e-09
atypical teratoid / rhabdoid tumor 2.500 5.2e-06
medulloblastoma, large-cell 3.500 1.5e-08
primitive neuroectodermal tumor 3.400 7.2e-07
Atopic dermatitis 1.800 1.9e-04
adrenocortical carcinoma 1.143 1.4e-02
non-small cell lung cancer 2.113 2.2e-20
intraductal papillary-mucinous carcinoma... 1.600 1.8e-03
intraductal papillary-mucinous neoplasm ... 2.500 3.4e-04
colon cancer 3.000 7.8e-03
lung cancer 4.000 2.3e-05
breast carcinoma 1.400 4.3e-05
pediatric high grade glioma 2.500 3.9e-07
pilocytic astrocytoma 1.200 8.2e-06
posterior fossa group A ependymoma 1.200 9.9e-04
lung adenocarcinoma 1.400 6.8e-06
psoriasis 1.800 6.1e-101
Endometriosis 1.324 2.2e-02
Breast cancer 1.900 8.4e-09
lung carcinoma 1.100 4.1e-08
ductal carcinoma in situ 1.200 2.6e-02
invasive ductal carcinoma 1.400 5.8e-03
ulcerative colitis 1.100 4.2e-03
ovarian cancer 1.400 1.1e-03

Gene RIF (2)

PMID Text
15961401 the Spc24, Spc25, Nuf2, and Ndc80/Hec1 complex is a faithful copy of the endogenous Ndc80 complex
14699129 hSPC25 is an essential kinetochore component that plays a significant role in proper execution of mitotic events

AA Sequence

MVEDELALFDKSINEFWNKFKSTDTSCQMAGLRDTYKDSIKAFAEKLSVKLKEEERMVEMFLEYQNQISR      1 - 70
QNKLIQEKKDNLLKLIAEVKGKKQELEVLTANIQDLKEEYSRKKETISTANKANAERLKRLQKSADLYKD     71 - 140
RLGLEIRKIYGEKLQFIFTNIDPKNPESPFMFSLHLNEARDYEVSDSAPHLEGLAEFQENVRKTNNFSAF    141 - 210
LANVRKAFTATVYN                                                            211 - 224
//

Text Mined References (16)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23085020 2012 The kinetochore-bound Ska1 complex tracks depolymerizing microtubules and binds to curved protofilaments.
21269460 2011 Initial characterization of the human central proteome.
20360068 2010 Systematic analysis of human protein complexes identifies chromosome segregation proteins.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15961401 2005 Architecture of the human ndc80-hec1 complex, a critical constituent of the outer kinetochore.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14738735 2004 The vertebrate Ndc80 complex contains Spc24 and Spc25 homologs, which are required to establish and maintain kinetochore-microtubule attachment.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14699129 2004 Identification of two novel components of the human NDC80 kinetochore complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9585408 1998 The beta subunit of the Sec61 complex facilitates cotranslational protein transport and interacts with the signal peptidase during translocation.