Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.52
PubTator Score 0.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -7.600 4.9e-10
psoriasis -2.100 2.7e-04
osteosarcoma 2.041 3.2e-05
adrenocortical carcinoma 1.678 3.6e-06
non-small cell lung cancer 1.210 1.0e-23
lung cancer 1.200 3.4e-02
adult high grade glioma -1.300 2.6e-03
lung carcinoma 1.200 2.0e-16
progressive supranuclear palsy 1.100 3.7e-02
invasive ductal carcinoma 1.200 6.9e-03
ulcerative colitis 1.600 1.5e-08
ovarian cancer 2.000 2.0e-06

Synonym

Accession Q86XZ4 A8K8G9 Q9H7D4 Q9H8Y7 Q9H8Z8
Symbols SCR59
P59SCR
SPATA10
Nbla00526

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
22190034 HIV-1 Rev is identified to have a physical interaction with spermatogenesis associated, serine-rich 2 (SPATS2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSRKQNQKDSSGFIFDLQSNTVLAQGGAFENMKEKINAVRAIVPNKSNNEIILVLQHFDNCVDKTVQAFM      1 - 70
EGSASEVLKEWTVTGKKKNKKKKNKPKPAAEPSNGIPDSSKSVSIQEEQSAPSSEKGGMNGYHVNGAIND     71 - 140
TESVDSLSEGLETLSIDARELEDPESAMLDTLDRTGSMLQNGVSDFETKSLTMHSIHNSQQPRNAAKSLS    141 - 210
RPTTETQFSNMGMEDVPLATSKKLSSNIEKSVKDLQRCTVSLARYRVVVKEEMDASIKKMKQAFAELESC    211 - 280
LMDREVALLAEMDKVKAEAMEILLSRQKKAELLKKMTHVAVQMSEQQLVELRADIKHFVSERKYDEDLGR    281 - 350
VARFTCDVETLKKSIDSFGQVSHPKNSYSTRSRCSSVTSVSLSSPSDASAASSSTCASPPSLTSANKKNF    351 - 420
APGETPAAIANSSGQPYQPLREVLPGNRRGGQGYRPQGQKSNDPMNQGRHDSMGRYRNSSWYSSGSRYQS    421 - 490
APSQAPGNTIERGQTHSAGTNGTGVSMEPSPPTPSFKKGLPQRKPRTSQTEAVNS                   491 - 545
//

Text Mined References (13)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17989879 2007 Microarray analysis of bisphenol A-induced changes in gene expression in human oral epithelial cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12880961 2003 Neuroblastoma oligo-capping cDNA project: toward the understanding of the genesis and biology of neuroblastoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11944913 2002 Identification of a novel protein p59(scr), which is expressed at specific stages of mouse spermatogenesis.