Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.61
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Synonym

Accession Q76KD6 B4DWW9 Q5U5I8 Q7Z6L7
Symbols SPATA15

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA Inparanoid

Gene RIF (1)

PMID Text
20542897 Speriolin is a novel centrosomal protein present in the connecting piece region of human sperm that is transmitted to the zygote and can be detected throughout the first mitotic division.

AA Sequence

MSLLTNYEGLRHQIERLVRENEELKKLVRLIRENHELKSAIKTQAGGLGISGFTSGLGEATAGLSSRQNN      1 - 70
GVFLPPSPAVANERVLEEVGIMALAPLAEMLTSLQPSATPGSLMSPLTGTLSTLLSGPAPTSQSSPLTSF     71 - 140
LTSPIAGPLTGTLASSLGLPSTGTLTPSSLVAGPVAMSQSSPLIAPVMGTVAVSLSSPLLSSTATPPGVS    141 - 210
QNLLANPMSNLVLPEAPRLRLAEPLRGGPTGPQSPACVVPTATTKVPLSTEPPQSTQDPEPLSMAFAGAP    211 - 280
LQTSTPIGAMGTPAPKTAFSFNTSDTQAQPSAAQEQVVPASVPTSPTTSPTVTVLASAPALAPQVATSYT    281 - 350
PSSTTHIAQGAPHPPSRMHNSPTQNLPVPHCPPHNAHSPPRTSSSPASVNDSRGPRTTEPSTKSMMEVER    351 - 420
KLAHRKTSKFPENPRESKQLAWERLVGEIAFQLDRRILSSIFPERVRLYGFTVSNIPEKIIQASLNPSDH    421 - 490
KLDEKLCQRLTQRYVSVMNRLQSLGYNGRVHPALTEQLVNAYGILRERPELAASEGGPYTVDFLQRVVVE    491 - 560
TVHPGMLADALLLLSCLSQLAHDDGKPMFIW                                           561 - 591
//

Text Mined References (7)

PMID Year Title
20542897 2010 Speriolin is a novel human and mouse sperm centrosome protein.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15280373 2004 Speriolin is a novel spermatogenic cell-specific centrosomal protein associated with the seventh WD motif of Cdc20.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.