Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.95
PubTator Score 1.33

Knowledge Summary


No data available


  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5



Accession Q6RVD6 Q2KJ07
Symbols SRG8


  Ortholog (1)

Species Source Disease

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

HGRIQRVQRRRVPSASPLIQKINRRSVLFHPYCWS                                        71 - 105

Text Mined References (11)

PMID Year Title