Property Summary

NCBI Gene PubMed Count 8
PubMed Score 40.87
PubTator Score 4.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Astrocytoma, Pilocytic 1.900 4.8e-11
atypical teratoid / rhabdoid tumor 1.200 1.5e-04
chronic rhinosinusitis -1.580 1.1e-02
cutaneous lupus erythematosus -1.300 1.8e-03
cystic fibrosis and chronic rhinosinusit... -1.133 3.7e-02
ependymoma 1.600 1.1e-02
glioblastoma 1.300 9.1e-07
interstitial cystitis -1.100 7.6e-04
invasive ductal carcinoma -1.013 1.1e-04
lung adenocarcinoma -1.300 1.7e-14
malignant mesothelioma -1.300 1.6e-05
medulloblastoma, large-cell -1.200 9.0e-03
ovarian cancer -1.600 1.9e-06
pediatric high grade glioma 1.500 4.4e-07
primitive neuroectodermal tumor 1.200 4.1e-02
psoriasis -1.300 2.1e-03
urothelial carcinoma -1.200 2.7e-02

Gene RIF (1)

AA Sequence

MPKVKALQCALALEISSVTCPGVVLKDKEDIYLSICVFGQYKKTQCVPATFPLVFNARMVFEKVFPDAVD      1 - 70
PGDVVTQLEYDTAVFELIQLVPPVGETLSTYDENTRDFMFPGPNQMSGHHDSNRQVTMRRISGLRGNAPR     71 - 140
LEFSTTSVITECLISSRKCHTQDKFIYHLAPVEKSHGRLQNRTSRSQKKKSKSPERSKYCINAKNYEQPT    141 - 210
ISSKSHSPSPYTKRRMCELSEDTRRRLAHLNLGPYEFKKETDKPPFVIRHVDPPSPRADTLLGSSGRDCE    211 - 280
RDGWSRVHNDHSHLGCCRPKDYKVIRTPHGRDFDDSLEKCEEYLSPRSCSKPRHSARTLLVHSAPSTMPK    281 - 350
HSPSPVLNRASLRERFHSDWCSPSNCDEIHDRVKNVLKSHQAHQRHLYDERDLEKDDELELKRSLLCRDS    351 - 420
AYDSDPEYSSCQQPRGTFHLDDGEYWSNRAASYKGKSHRPIFENSMDKMYRNLYKKACSSASHTQESF      421 - 488
//

Text Mined References (9)

PMID Year Title