Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 8.2e-07
osteosarcoma 7950 2.7e-05
medulloblastoma, large-cell 6241 8.5e-04

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.100 8.5e-04
osteosarcoma 1.121 2.7e-05
ovarian cancer 1.300 8.2e-07

AA Sequence

MENFSLLSISGPPISSSALSAFPDIMFSRATSLPDIAKTAVPTEASSPAQALPPQYQSIIVRQGIQNTAL      1 - 70
SPDCSLGDTQHGEKLRRNCTIYRPWFSPYSYFVCADKESQLEAYDFPEVQQDEGKWDNCLSEDMAENICS     71 - 140
SSSSPENTCPREATKKSRHGLDSITSQDILMASRWHPAQQNGYKCVACCRMYPTLDFLKSHIKRGFREGF    141 - 210
SCKVYYRKLKALWSKEQKARLGDRLSSGSCQAFNSPAEHLRQIGGEAYLCL                       211 - 261
//

Text Mined References (7)

PMID Year Title