Property Summary

NCBI Gene PubMed Count 9
PubMed Score 10.24
PubTator Score 7.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
osteosarcoma 1.094 6.9e-06
posterior fossa group B ependymoma 5.100 3.2e-15
cystic fibrosis 1.269 4.4e-03
atypical teratoid/rhabdoid tumor 1.600 9.4e-04
glioblastoma 1.200 4.1e-03
medulloblastoma, large-cell 1.800 1.6e-07
primitive neuroectodermal tumor 1.100 3.1e-02
acute quadriplegic myopathy 1.051 4.5e-10
non-small cell lung cancer -1.024 7.7e-07
intraductal papillary-mucinous adenoma (... 1.900 1.8e-03
active ulcerative colitis 1.062 1.9e-02
lung adenocarcinoma -1.200 3.2e-08
group 4 medulloblastoma 1.600 1.1e-02
pilocytic astrocytoma 2.200 8.2e-07
subependymal giant cell astrocytoma 2.544 8.7e-03
nasopharyngeal carcinoma -2.600 9.7e-04
Breast cancer -2.000 1.1e-04
invasive ductal carcinoma -1.500 1.0e-02
ovarian cancer 1.900 6.1e-04
pituitary cancer -1.100 4.5e-03
chronic rhinosinusitis -1.927 2.8e-02

Gene RIF (5)

PMID Text
22292033 The physical interaction of Mieap, BNIP3 and NIX at the mitochondrial outer membrane may play a critical role in the translocation of lysosomal proteins from the cytoplasm to the mitochondrial matrix.
21300779 show that SPATA18 transcription is induced by p53 in a variety of cell types of both human and mouse origin
21264228 Mieap induced vacuole-like structures (designated as MIV for Mieap-induced vacuole), which engulfed and degraded the unhealthy mitochondria by accumulating lysosomes
21264221 Mieap induces intramitochondrial lysosome-like organella that plays a critical role in mitochondrial quality control by eliminating oxidized mitochondrial proteins
16088906 beta-sarcoglycan and SPATA18 may have a role in limb-girdle muscular dystrophy type 2E

AA Sequence

MAENLKRLVSNETLRTLQEKLDFWLKEYNTNTCDQNLNHCLELIEQVAKVQGQLFGILTAAAQEGGRNDG      1 - 70
VETIKSRLLPWLEASFTAASLGKSVDSKVPSLQDTFDRERHKDPSPRDRDMQQLDSNLNSTRSQCNQVQD     71 - 140
DLVETEKNLEESKNRSAISLLAAEEEINQLKKQLKSLQAQEDARHRNTDQRSSENRRSEPWSLEERKREQ    141 - 210
WNSLKQNADQQDTEAMSDYKKQLRNLKEEIAVLSAEKSALQGRSSRSRSPSPAPRSRSCSRSRSASPSTA    211 - 280
VKVRRPSPNRSKLSNVARKAALLSRFSDSYSQARLDAQCLLRRCIDKAETVQRIIYIATVEAFHVAKMAF    281 - 350
RHFKIHVRKSLTPSYVGSNDFENAVLDYVICHLDLYDSQSSVNDVIRAMNVNPKISFPPVVDFCLLSDFI    351 - 420
QEICCIAFAMQALEPPLDIAYGADGEVFNDCKYRRSYDSDFTAPLVLYHVWPALMENDCVIMKGEAVTRR    421 - 490
GAFWNSVRSVSRCRSRSLSPICPRSQIGLNTMSRSRSPSPIRCGLPRF                          491 - 538
//

Text Mined References (10)

PMID Year Title
22292033 2012 BNIP3 and NIX mediate Mieap-induced accumulation of lysosomal proteins within mitochondria.
21300779 2011 SPATA18, a spermatogenesis-associated gene, is a novel transcriptional target of p53 and p63.
21264228 2011 Mieap, a p53-inducible protein, controls mitochondrial quality by repairing or eliminating unhealthy mitochondria.
21264221 2011 Possible existence of lysosome-like organella within mitochondria and its role in mitochondrial quality control.
16088906 2005 Homozygous microdeletion of chromosome 4q11-q12 causes severe limb-girdle muscular dystrophy type 2E with joint hyperlaxity and contractures.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15236321 2004 Complementary DNA cloning of rat spetex-1, a spermatid-expressing gene-1, encoding a 63 kDa cytoplasmic protein of elongate spermatids.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.