Property Summary

NCBI Gene PubMed Count 12
PubMed Score 7.02
PubTator Score 12.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Spermatogenic Failure 6 1 0.0 0.0
Disease Target Count
Globozoospermia 1
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Melanoma 689 0.0 0.5
Skin cancer 451 0.0 0.6
Disease Target Count Z-score Confidence
Prostate cancer 164 0.0 1.0

Gene RIF (7)

AA Sequence

MDAGSSRSLENAVNRIYHDQLVPKINTSKKMSTLAHPPNILEMSQEIKKNCGGKQVEITLERTKMTKGIK      1 - 70
EKQSNDLEKAAFKRKAEGEEKPTRKKQAKITELDNQLITMPLPHIPLKNIMDVEMKLVYIDEMGVRYEFV     71 - 140
ESFMSTGSQPTCQAAEIVDPLSVHNFSFLPQIDKWLQVALKDASSCYRQKKYALAAGQFRTALELCSKGA    141 - 210
VLGEPFDAPAEDIASVASFIETKLVTCYLRMRKPDLALNHAHRSIVLNPAYFRNHLRQATVFRCLERYSE    211 - 280
AARSAMIADYMFWLGGGREESISKLIKLYWQAMIEEAITRAESFSVMYTPFATKIRADKIEKVKDAFTKT    281 - 350
HPAYAEYMYTDLQALHMLPQTVDWSSFPPQQYLLTLGFKNKDDGKFLEKISSRKLPIFTEHKTPFGLTRE    351 - 420
DTVRQMETMGKRILPILDFIRSTQLNGSFPASSGVMEKLQYASLLSQLQRVKEQSQVINQAMAELATIPY    421 - 490
LQDISQQEAELLQSLMADAMDTLEGRRNNNERVWNMIQKVGQIEDFLYQLEDSFLKTKKLRTARRQKTKM    491 - 560
KRLQTVQQR                                                                 561 - 569
//

Text Mined References (14)

PMID Year Title