Property Summary

NCBI Gene PubMed Count 18
PubMed Score 0.00
PubTator Score 9.35

Knowledge Summary

Patent

No data available

Gene RIF (8)

PMID Text
25229454 Epigenetic mechanisms underlying the dynamic expression of cancer-testis genes, PAGE2, -2B and SPANX-B, during mesenchymal-to-epithelial transition
20073942 Copy number variation of the entire gene cluster containing all four SPANXA-E genes and with SPANXB, found exclusively in maturing sperm. Average CNV patterns did not differ between fertile and infertile men.
20073942 Observational study of gene-disease association. (HuGE Navigator)
19417550 SPANX-B (Xq27 region) gene dosage analysis in Down's syndrome subjects with undescended testes
18626316 genetic variability of SPANX-B and SPANX-C in a sample of Sicilian male population including patients with melanoma of the skin and controls; Sixteen and 13 genetic classes were detected for SPANX-B and SPANX-C genes, respectively
18626316 Observational study of gene-disease association. (HuGE Navigator)
17342728 Human VCX/Y, SPANX, and CSAG2 gene families together with the murine SPANX gene and the CYPT family may share a common ancestor.
12393489 correlation between SPAN-Xb gene expression and B-cell immune responses in myeloma and other hematologic malignancies

AA Sequence

MGQQSSVRRLKRSVPCESNEANEANEANKTMPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNVKRTSP      1 - 70
EELLNDHARENRINPDQMEEEEFIEITTERPKK                                          71 - 103
//

Text Mined References (18)

PMID Year Title
25229454 2014 Epigenetic mechanisms underlying the dynamic expression of cancer-testis genes, PAGE2, -2B and SPANX-B, during mesenchymal-to-epithelial transition.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20073942 2010 SPANX gene variation in fertile and infertile males.
19417550 2009 SPANX-B and SPANX-C (Xq27 region) gene dosage analysis in Down's syndrome subjects with undescended testes.
18626316 2008 SPANX-B and SPANX-C (Xq27 region) gene dosage analysis in Sicilian patients with melanoma.
17342728 2008 A shared promoter region suggests a common ancestor for the human VCX/Y, SPANX, and CSAG gene families and the murine CYPT family.
17012309 2006 Hominoid-specific SPANXA/D genes demonstrate differential expression in individuals and protein localization to a distinct nuclear envelope domain during spermatid morphogenesis.
16390498 2006 Expression of SpanX proteins in normal testes and in testicular germ cell tumours.
16251457 2005 Dynamic structure of the SPANX gene cluster mapped to the prostate cancer susceptibility locus HPCX at Xq27.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14973187 2004 The SPANX gene family of cancer/testis-specific antigens: rapid evolution and amplification in African great apes and hominids.
14734458 2004 Genomic organization, incidence, and localization of the SPAN-x family of cancer-testis antigens in melanoma tumors and cell lines.
12758128 2003 The human SPANX multigene family: genomic organization, alignment and expression in male germ cells and tumor cell lines.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393489 2003 Gene expression and immunologic consequence of SPAN-Xb in myeloma and other hematologic malignancies.
11133693 2001 Differential nuclear localization of the cancer/testis-associated protein, SPAN-X/CTp11, in transfected cells and in 50% of human spermatozoa.
10906052 2000 Spermatid-specific expression of the novel X-linked gene product SPAN-X localized to the nucleus of human spermatozoa.