Property Summary

NCBI Gene PubMed Count 53
PubMed Score 250.61
PubTator Score 104.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytic glioma 2.000 2.3e-03
ependymoma 1.500 1.6e-02
oligodendroglioma 1.900 3.5e-04
psoriasis -1.400 5.4e-11
osteosarcoma 2.879 3.9e-06
group 4 medulloblastoma 2.000 1.0e-04
atypical teratoid / rhabdoid tumor 1.700 3.2e-04
glioblastoma 1.500 1.3e-02
medulloblastoma, large-cell 2.500 1.8e-06
primitive neuroectodermal tumor 1.100 1.6e-03
ulcerative colitis -1.026 8.4e-04
hereditary spastic paraplegia -1.078 1.6e-02
acute quadriplegic myopathy 1.216 8.2e-05
tuberculosis -1.700 3.2e-09
intraductal papillary-mucinous adenoma (... -1.500 8.3e-05
intraductal papillary-mucinous carcinoma... -1.500 1.1e-03
Pick disease 2.400 9.1e-06
ovarian cancer -2.400 1.2e-10
Gaucher disease type 1 -1.600 9.6e-03
Down syndrome 1.200 6.8e-04
dermatomyositis 1.800 1.8e-03

Gene RIF (31)

PMID Text
27352556 expression of SPAG9 in ECC cells with TGF-beta1 treatment and spheroids formation was increased
26797273 Based on in vitro assays, we found miR-200a-3p significantly inhibit cancer cell proliferation by inducing apoptosis.
26790956 Study suggest that suppression of miR-141 may cause an aberrant overexpression of SPAG9 promoting growth and metastasis of hepatocellular carcinoma cells.
26468278 FOXK1 protein levels and activity are regulated by associating with JLP and PLK1
26293216 SPAG9 overexpression in gastric cancer correlates with poor prognosis and contributes to gastric cancer cell proliferation
26291670 PLK1 binding to JIP4 was found in G2 phase and mitosis, and PLK1 binding was self-primed by PLK1 phosphorylation of JIP4.
25310386 SPAG9 expression is significantly increased in prostate cancer and it may be involved in the process of prostate cancer cell motility, migration and angiogenesis.
25244576 knockdown of Sec8 enhances the binding of JIP4 to MAPK kinase 4, thereby decreasing the phosphorylation of MAPK kinase 4, JNK, and p38.
25033008 SPAG9 was upregulated in nonmelanoma skin cancer when compared with normal skin.
24801907 SPAG9 is overexpressed in human HCC and serves as a prognostic marker. SPAG9 contributes to cancer cell growth through regulation of cyclin proteins.
24788963 SPAG9 upregulates PODXL expression in human astrocytoma cells at the PODXL gene promoter/transcriptional level through a JNKdependent mechanism.
24740566 SPAG9 is overexpressed in human prostate cancers and contributes to prostate cancer cell growth, possibly through cyclin protein regulation.
24460345 High SPAG9 expression is associated with endometrial cancer.
24349057 data in clinical specimens indicated that SPAG9 is potential biomarker and therapeutic target for bladder TCC.
24330581 down regulation of SPAG9 reduces growth and invasive potential of triple-negative breast cancer cells, suggesting that SPAG9 may be a potential target for therapeutic use.
23711689 SPAG9 depletion could inhibit the activity of p-JNK.
23696027 SPAG9 serves as an important oncoprotein in human astrocytoma by regulating cell proliferation and invasion.
22146769 SPAG9 is positively expressed in endometrial cancer, and with a high humoral immune response in patients. It may serve as a new type of endometrial cancer markers for early detection, diagnosis and treatment.
21356354 These findings collectively suggest that SPAG9 may have a role in tumor development and early spread.
21177868 N-cadherin expression had an inhibitory effect on JLP-mediated p38 MAPK signal activation by decreasing the interaction between JLP and p38 MAPK
20138665 SPAG9 mRNA& protein are expressed in CML patients (88%) and in K562 & KCL-22 cells. 90% CML chronic-phase patients showed humoral response against SPAG9.
19947555 SPAG9 protein is found in the equatorial plate and flagella of human spermatozoa.
19820019 Findings support a potential role for SPAG9 as diagnostic biomarker as well as a possible therapeutic target in thyroid cancer treatment.
19644450 structural analysis of ARF6 in a complex with JIP4
19056739 Kinesin adapter JLP links PIKfyve to microtubule-based endosome-to-trans-Golgi network traffic of furin.
18922895 SPAG9 may have a role in tumor development and metastasis and thus could serve as a novel target for early detection and treatment of renal cell carcinoma.
16959808 Recombinant human protein is adsorbed on alum is highly immunogenic in macaca model and therefore represents a suitable sperm-based vaccine immunogen for fertility trials in macaque.
16356479 The present investigation will eventually extend the application of SPAG9 siRNA in in vivo targeting experiments that aim to define the SPAG9 functional genomics in tumor and reproductive biology.
16077255 SPAG9 is a new member of c-Jun NH2 -terminal kinase (JNK) interacting protein exclusively expressed in testis
15693750 first report of sperm-associated JNK-binding protein (SPAG9) that may have a role in spermatozoa-egg interaction
14662895 Testicular antigen PHET is an auutoantigen recognized by sera from systemic sclerosis (SSc) patients with extensive fibrotic changes; the autoantibody response to PHET is induced by ectopic overexpression of PHET in dermal fibroblasts of SSc patients.

AA Sequence

MELEDGVVYQEEPGGSGAVMSERVSGLAGSIYREFERLIGRYDEEVVKELMPLVVAVLENLDSVFAQDQE      1 - 70
HQVELELLRDDNEQLITQYEREKALRKHAEEKFIEFEDSQEQEKKDLQTRVESLESQTRQLELKAKNYAD     71 - 140
QISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERTKLHQLSGSDQLESTAHSRIRKERPISLGIFPLP    141 - 210
AGDGLLTPDAQKGGETPGSEQWKFQELSQPRSHTSLKVSNSPEPQKAVEQEDELSDVSQGGSKATTPAST    211 - 280
ANSDVATIPTDTPLKEENEGFVKVTDAPNKSEISKHIEVQVAQETRNVSTGSAENEEKSEVQAIIESTPE    281 - 350
LDMDKDLSGYKGSSTPTKGIENKAFDRNTESLFEELSSAGSGLIGDVDEGADLLGMGREVENLILENTQL    351 - 420
LETKNALNIVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEEKNRELEEELRKARAEAEDARQKAKDD    421 - 490
DDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRENPAMQEKKRSSIWQFFSRLF    491 - 560
SSSSNTTKKPEPPVNLKYNAPTSHVTPSVKKRSSTLSQLPGDKSKAFDFLSEETEASLASRREQKREQYR    561 - 630
QVKAHVQKEDGRVQAFGWSLPQKYKQVTNGQGENKMKNLPVPVYLRPLDEKDTSMKLWCAVGVNLSGGKT    631 - 700
RDGGSVVGASVFYKDVAGLDTEGSKQRSASQSSLDKLDQELKEQQKELKNQEELSSLVWICTSTHSATKV    701 - 770
LIIDAVQPGNILDSFTVCNSHVLCIASVPGARETDYPAGEDLSESGQVDKASLCGSMTSNSSAETDSLLG    771 - 840
GITVVGCSAEGVTGAATSPSTNGASPVMDKPPEMEAENSEVDENVPTAEEATEATEGNAGSAEDTVDISQ    841 - 910
TGVYTEHVFTDPLGVQIPEDLSPVYQSSNDSDAYKDQISVLPNEQDLVREEAQKMSSLLPTMWLGAQNGC    911 - 980
LYVHSSVAQWRKCLHSIKLKDSILSIVHVKGIVLVALADGTLAIFHRGVDGQWDLSNYHLLDLGRPHHSI    981 - 1050
RCMTVVHDKVWCGYRNKIYVVQPKAMKIEKSFDAHPRKESQVRQLAWVGDGVWVSIRLDSTLRLYHAHTY   1051 - 1120
QHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCNRLWVGTGNGVIISIPLTETNKTSGVPGNRPGSVI   1121 - 1190
RVYGDENSDKVTPGTFIPYCSMAHAQLCFHGHRDAVKFFVAVPGQVISPQSSSSGTDLTGDKAGPSAQEP   1191 - 1260
GSQTPLKSMLVISGGEGYIDFRMGDEGGESELLGEDLPLEPSVTKAERSHLIVWQVMYGNE            1261 - 1321
//

Text Mined References (65)

PMID Year Title
27352556 2016 SPAG9 promotes endometrial carcinoma cell invasion through regulation of genes related to the epithelial-mesenchymal transition.
26797273 2016 MicroRNA-200a-3p suppresses tumor proliferation and induces apoptosis by targeting SPAG9 in renal cell carcinoma.
26790956 2016 Direct targeting sperm-associated antigen 9 by miR-141 influences hepatocellular carcinoma cell growth and metastasis via JNK pathway.
26468278 2015 JNK-associated Leucine Zipper Protein Functions as a Docking Platform for Polo-like Kinase 1 and Regulation of the Associating Transcription Factor Forkhead Box Protein K1.
26293216 2015 Overexpression of SPAG9 in human gastric cancer is correlated with poor prognosis.
26291670 2015 JIP4 is a PLK1 binding protein that regulates p38MAPK activity in G2 phase.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25310386 2014 SPAG9 expression is increased in human prostate cancer and promotes cell motility, invasion and angiogenesis in vitro.
25244576 2014 Knockdown of Sec8 enhances the binding affinity of c-Jun N-terminal kinase (JNK)-interacting protein 4 for mitogen-activated protein kinase kinase 4 (MKK4) and suppresses the phosphorylation of MKK4, p38, and JNK, thereby inhibiting apoptosis.
25033008 2015 Immunohistochemical expression of sperm-associated antigen 9 in nonmelanoma skin cancer.
24801907 2014 Overexpression of SPAG9 correlates with poor prognosis and tumor progression in hepatocellular carcinoma.
24788963 2014 Sperm?associated antigen 9 promotes astrocytoma cell invasion through the upregulation of podocalyxin.
24740566 2014 SPAG9 is overexpressed in human prostate cancer and promotes cancer cell proliferation.
24460345 2013 Sperm-associated antigen 9 is a promising marker for early diagnosis of endometrial cancer.
24349057 2013 Sperm associated antigen 9 plays an important role in bladder transitional cell carcinoma.
24330581 2013 Down regulation of SPAG9 reduces growth and invasive potential of triple-negative breast cancer cells: possible implications in targeted therapy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23711689 2013 Clinical significance and biological roles of SPAG9 overexpression in non-small cell lung cancer.
23696027 2013 SPAG9 is overexpressed in human astrocytoma and promotes cell proliferation and invasion.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22522702 2012 Structural basis for Arf6-MKLP1 complex formation on the Flemming body responsible for cytokinesis.
22146769 2012 Expression and clinical significance of sperm-associated antigen 9 in patients with endometrial carcinoma.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21356354 2011 Sperm-associated antigen 9 is a novel biomarker for colorectal cancer and is involved in tumor growth and tumorigenicity.
21269460 2011 Initial characterization of the human central proteome.
21177868 2011 N-cadherin regulates p38 MAPK signaling via association with JNK-associated leucine zipper protein: implications for neurodegeneration in Alzheimer disease.
20138665 2010 Sperm associated antigen 9 expression and humoral response in chronic myeloid leukemia.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19947555 2009 [Expression and location of SPAG9 in human ejaculated spermatozoa].
19820019 2009 Sperm-associated antigen 9: a novel diagnostic marker for thyroid cancer.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19644450 2009 The structural basis of Arf effector specificity: the crystal structure of ARF6 in a complex with JIP4.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19056739 2009 Kinesin adapter JLP links PIKfyve to microtubule-based endosome-to-trans-Golgi network traffic of furin.
18922895 2008 Sperm-associated antigen 9 is associated with tumor growth, migration, and invasion in renal cell carcinoma.
18826971 2008 The scaffold protein c-Jun NH2-terminal kinase-associated leucine zipper protein regulates cell migration through interaction with the G protein G(alpha 13).
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16959808 2006 Immunogenicity study of recombinant human sperm-associated antigen 9 in bonnet macaque (Macaca radiata).
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16356479 2006 Small interference RNA-mediated knockdown of sperm associated antigen 9 having structural homology with c-Jun N-terminal kinase-interacting protein.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16112646 2005 Humoral detection of leukaemia-associated antigens in presentation acute myeloid leukaemia.
16077255 2005 Sperm associated antigen 9 (SPAG9): a new member of c-Jun NH2 -terminal kinase (JNK) interacting protein exclusively expressed in testis.
15923648 2005 Close encounters: regulation of vertebrate skeletal myogenesis by cell-cell contact.
15693750 2005 Characterization of a novel human sperm-associated antigen 9 (SPAG9) having structural homology with c-Jun N-terminal kinase-interacting protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14662895 2003 A novel protein highly expressed in testis is overexpressed in systemic sclerosis fibroblasts and targeted by autoantibodies.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12391307 2002 JLP: A scaffolding protein that tethers JNK/p38MAPK signaling modules and transcription factors.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
10557099 1999 From receptors to stress-activated MAP kinases.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
9480848 1998 Cloning of a novel human testis mRNA specifically expressed in testicular haploid germ cells, having unique palindromic sequences and encoding a leucine zipper dimerization motif.