Property Summary

NCBI Gene PubMed Count 14
PubMed Score 9.29
PubTator Score 24.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.600 7.9e-05
atypical teratoid / rhabdoid tumor -1.300 1.1e-04
Breast cancer -1.100 5.2e-04
chronic rhinosinusitis -1.068 2.4e-02
ependymoma 1.700 7.9e-05
glioblastoma -1.500 2.2e-06
malignant mesothelioma -1.900 1.1e-07
medulloblastoma -1.100 2.5e-03
medulloblastoma, large-cell -1.500 2.3e-05
nasopharyngeal carcinoma -1.100 1.9e-06
non primary Sjogren syndrome sicca 1.100 1.2e-02
osteosarcoma -2.336 7.7e-10
psoriasis -1.700 4.0e-04

 GO Function (1)

Gene RIF (3)

AA Sequence

METNESTEGSRSRSRSLDIQPSSEGLGPTSEPFPSSDDSPRSALAAATAAAAAAASAAAATAAFTTAKAA      1 - 70
ALSTKTPAPCSEFMEPSSDPSLLGEPCAGPGFTHNIAHGSLGFEPVYVSCIAQDTCTTTDHSSNPGPVPG     71 - 140
SSSGPVLGSSSGAGHGSGSGSGPGCGSVPGSGSGPGPGSGPGSGPGHGSGSHPGPASGPGPDTGPDSELS    141 - 210
PCIPPGFRNLVADRVPNYTSWSQHCPWEPQKQPPWEFLQVLEPGARGLWKPPDIKGKLMVCYETLPRGQC    211 - 280
LLYNWEEERATNHLDQVPSMQDGSESFFFRHGHRGLLTMQLKSPMPSSTTQKDSYQPPGNVYWPLRGKRE    281 - 350
AMLEMLLQHQICKEVQAEQEPTRKLFEVESVTHHDYRMELAQAGTPAPTKPHDYRQEQPETFWIQRAPQL    351 - 420
PVCEGD                                                                    421 - 426
//

Text Mined References (15)

PMID Year Title