Property Summary

NCBI Gene PubMed Count 9
PubMed Score 83.03
PubTator Score 9.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
acute myeloid leukemia -1.400 8.9e-03
diabetes mellitus -1.100 7.9e-03

Gene RIF (1)

AA Sequence

MADLLGSILSSMEKPPSLGDQETRRKAREQAARLKKLQEQEKQQKVEFRKRMEKEVSDFIQDSGQIKKKF      1 - 70
QPMNKIERSILHDVVEVAGLTSFSFGEDDDCRYVMIFKKEFAPSDEELDSYRRGEEWDPQKAEEKRKLKE     71 - 140
LAQRQEEEAAQQGPVVVSPASDYKDKYSHLIGKGAAKDAAHMLQANKTYGCVPVANKRDTRSIEEAMNEI    141 - 210
RAKKRLRQSGEELPPTS                                                         211 - 227
//

Text Mined References (16)

PMID Year Title