Property Summary

NCBI Gene PubMed Count 24
PubMed Score 51.16
PubTator Score 15.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 5.4e-12
ependymoma 4679 4.7e-10
nasopharyngeal carcinoma 1058 3.7e-08
lung adenocarcinoma 2716 1.1e-07
Astrocytoma, Pilocytic 3081 3.9e-04
group 4 medulloblastoma 1855 1.3e-03
glioblastoma 5792 6.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Hydrocephalus 152 3.799 1.9
Primary ciliary dyskinesia 76 3.517 1.8

Expression

  Differential Expression (7)

Disease log2 FC p
Astrocytoma, Pilocytic -1.300 3.9e-04
ependymoma 3.900 4.7e-10
glioblastoma -1.100 6.0e-03
group 4 medulloblastoma 1.200 1.3e-03
lung adenocarcinoma -1.900 1.1e-07
nasopharyngeal carcinoma -2.300 3.7e-08
psoriasis -1.200 5.4e-12

Gene RIF (7)

AA Sequence

MSQRQVLQVFEQYQKARTQFVQMVAELATRPQNIETLQNAGVMSLLRTLLLDVVPTIQQTAALALGRLAN      1 - 70
YNDDLAEAVVKCDILPQLVYSLAEQNRFYKKAAAFVLRAVGKHSPQLAQAIVDCGALDTLVICLEDFDPG     71 - 140
VKEAAAWALRYIARHNAELSQAVVDAGAVPLLVLCIQEPEIALKRIAASALSDIAKHSPELAQTVVDAGA    141 - 210
VAHLAQMILNPDAKLKHQILSALSQVSKHSVDLAEMVVEAEIFPVVLTCLKDKDEYVKKNASTLIREIAK    211 - 280
HTPELSQLVVNAGGVAAVIDCIGSCKGNTRLPGIMMLGYVAAHSENLAMAVIISKGVPQLSVCLSEEPED    281 - 350
HIKAAAAWALGQIGRHTPEHARAVAVTNTLPVLLSLYMSTESSEDLQVKSKKAIKNILQKCTYLPALEPF    351 - 420
LYDAPPNILKHVVGQFSKVLPHDSKARRLFVTSGGLKKVQEIKAEPGSLLQEYINSINSCYPEEIVRYYS    421 - 490
PGYSDTLLQRVDSYQPLNN                                                       491 - 509
//

Text Mined References (26)

PMID Year Title