Property Summary

NCBI Gene PubMed Count 24
PubMed Score 47.32
PubTator Score 33.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma 1.700 3.4e-07
group 3 medulloblastoma 2.300 1.3e-05
medulloblastoma, large-cell 1.200 2.5e-03
Atopic dermatitis 1.100 1.2e-04
adrenocortical carcinoma 1.484 1.1e-03
tuberculosis and treatment for 3 months -1.400 1.8e-06
non-small cell lung cancer 2.484 9.5e-28
intraductal papillary-mucinous carcinoma... 1.100 2.2e-03
intraductal papillary-mucinous neoplasm ... 1.400 1.3e-03
lung cancer 2.900 1.9e-05
breast carcinoma 1.500 7.0e-04
Breast cancer 2.500 3.6e-02
lung adenocarcinoma 3.000 1.3e-15
Endometriosis 1.039 1.1e-02
ductal carcinoma in situ 1.500 2.1e-02
invasive ductal carcinoma 1.800 6.6e-04
psoriasis 1.300 1.2e-97

Gene RIF (15)

PMID Text
27095104 Molecular requirements for the inter-subunit interaction and kinetochore recruitment of SKAP and Astrin have been reported.
25009111 Astrin acts as a mitotic phosphoprotein during the regulation of mitosis.
24853425 SPAG5 upregulation relates to poor prognosis in cervical cancer patients, and SPAG5 is a regulator of mTOR activity during taxol treatment in cervical cancer.
23953116 Study identifies astrin as an essential negative mTORC1 regulator in the cellular stress response. Upon stress, astrin inhibits mTORC1 association and recruits the mTORC1 component raptor to stress granules, thereby preventing mTORC1-hyperactivation-induced apoptosis.
22773063 The rsults of this study the increased expression of this gene may play a pathogenic role durin testicular development in subjects with DS and cryptorchidism.
22190034 HIV-1 gp41 is identified to have a physical interaction with sperm associated antigen 5 (SPAG5) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20852589 Data show that CLASP1-astrin-Kif2b complex acts as a central switch at kinetochores that defines mitotic progression and promotes fidelity by temporally regulating kinetochore-microtuble attachments.
20508983 Observational study of gene-disease association. (HuGE Navigator)
19197158 Results suggest that SNM1B/Apollo and Astrin function together to enforce the prophase checkpoint in response to spindle stress.
18361916 Astrin acts upstream of Aurora-A to regulate its mitotic spindle localization.
18055457 GSK3beta interacts with and phosphorylates the spindle-associated protein Astrin, resulting in targeting Astrin to the spindle microtubules and kinetochores.
17664331 Results report that depletion of the microtubule and kinetochore protein astrin results in checkpoint-arrested cells with multipolar spindles and separated sister chromatids, which is consistent with untimely separase activation.
17383637 a model is proposed wherein hNinein regulates the dynamic movement of Astrin throughout the cell cycle and this interaction, in turn, is required for maintenance of centrosome/spindle pole integrity.
16546135 These findings suggest that the silencing of astrin induce a p53-dependent apoptosis and has an additive effect on paclitaxel treatment.
11549262 hMap126 is abundantly expressed in testis and localized in mitotic spindle and may be involved in the functional and dynamic regulation of mitotic spindles.

AA Sequence

MWRVKKLSLSLSPSPQTGKPSMRTPLRELTLQPGALTNSGKRSPACSSLTPSLCKLGLQEGSNNSSPVDF      1 - 70
VNNKRTDLSSEHFSHSSKWLETCQHESDEQPLDPIPQISSTPKTSEEAVDPLGNYMVKTIVLVPSPLGQQ     71 - 140
QDMIFEARLDTMAETNSISLNGPLRTDDLVREEVAPCMGDRFSEVAAVSEKPIFQESPSHLLEESPPNPC    141 - 210
SEQLHCSKESLSSRTEAVREDLVPSESNAFLPSSVLWLSPSTALAADFRVNHVDPEEEIVEHGAMEEREM    211 - 280
RFPTHPKESETEDQALVSSVEDILSTCLTPNLVEMESQEAPGPAVEDVGRILGSDTESWMSPLAWLEKGV    281 - 350
NTSVMLENLRQSLSLPSMLRDAAIGTTPFSTCSVGTWFTPSAPQEKSTNTSQTGLVGTKHSTSETEQLLC    351 - 420
GRPPDLTALSRHDLEDNLLSSLVILEVLSRQLRDWKSQLAVPHPETQDSSTQTDTSHSGITNKLQHLKES    421 - 490
HEMGQALQQARNVMQSWVLISKELISLLHLSLLHLEEDKTTVSQESRRAETLVCCCFDLLKKLRAKLQSL    491 - 560
KAEREEARHREEMALRGKDAAEIVLEAFCAHASQRISQLEQDLASMREFRGLLKDAQTQLVGLHAKQEEL    561 - 630
VQQTVSLTSTLQQDWRSMQLDYTTWTALLSRSRQLTEKLTVKSQQALQERDVAIEEKQEVSRVLEQVSAQ    631 - 700
LEECKGQTEQLELENSRLATDLRAQLQILANMDSQLKELQSQHTHCAQDLAMKDELLCQLTQSNEEQAAQ    701 - 770
WQKEEMALKHMQAELQQQQAVLAKEVRDLKETLEFADQENQVAHLELGQVECQLKTTLEVLRERSLQCEN    771 - 840
LKDTVENLTAKLASTIADNQEQDLEKTRQYSQKLGLLTEQLQSLTLFLQTKLKEKTEQETLLLSTACPPT    841 - 910
QEHPLPNDRTFLGSILTAVADEEPESTPVPLLGSDKSAFTRVASMVSLQPAETPGMEESLAEMSIMTTEL    911 - 980
QSLCSLLQESKEEAIRTLQRKICELQARLQAQEEQHQEVQKAKEADIEKLNQALCLRYKNEKELQEVIQQ    981 - 1050
QNEKILEQIDKSGELISLREEVTHLTRSLRRAETETKVLQEALAGQLDSNCQPMATNWIQEKVWLSQEVD   1051 - 1120
KLRVMFLEMKNEKEKLMIKFQSHRNILEENLRRSDKELEKLDDIVQHIYKTLLSIPEVVRGCKELQGLLE   1121 - 1190
FLS                                                                      1191 - 1193
//

Text Mined References (34)

PMID Year Title
27095104 2016 Molecular requirements for the inter-subunit interaction and kinetochore recruitment of SKAP and Astrin.
26297806 2015 Centriolar satellites assemble centrosomal microcephaly proteins to recruit CDK2 and promote centriole duplication.
25416956 2014 A proteome-scale map of the human interactome network.
25009111 2014 The mitosis-regulating and protein-protein interaction activities of astrin are controlled by aurora-A-induced phosphorylation.
24853425 2014 SPAG5 upregulation predicts poor prognosis in cervical cancer patients and alters sensitivity to taxol treatment via the mTOR signaling pathway.
24424245 2014 OSBP-related protein 8 (ORP8) interacts with Homo sapiens sperm associated antigen 5 (SPAG5) and mediates oxysterol interference of HepG2 cell cycle.
23953116 2013 Inhibition of mTORC1 by astrin and stress granules prevents apoptosis in cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22773063 2013 SPAG5 mRNA is over-expressed in peripheral blood leukocytes of patients with Down's syndrome and cryptorchidism.
21402792 2011 The astrin-kinastrin/SKAP complex localizes to microtubule plus ends and facilitates chromosome alignment.
21269460 2011 Initial characterization of the human central proteome.
20852589 2010 CLASP1, astrin and Kif2b form a molecular switch that regulates kinetochore-microtubule dynamics to promote mitotic progression and fidelity.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19197158 2009 SNM1B/Apollo interacts with astrin and is required for the prophase cell cycle checkpoint.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18361916 2008 Astrin regulates Aurora-A localization.
18055457 2008 Glycogen synthase kinase 3beta interacts with and phosphorylates the spindle-associated protein astrin.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17664331 2007 Astrin is required for the maintenance of sister chromatid cohesion and centrosome integrity.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17383637 2007 hNinein is required for targeting spindle-associated protein Astrin to the centrosome during the S and G2 phases.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16546135 2006 Silencing of astrin induces the p53-dependent apoptosis by suppression of HPV18 E6 expression and sensitizes cells to paclitaxel treatment in HeLa cells.
15504738 2005 Genes affecting the cell cycle, growth, maintenance, and drug sensitivity are preferentially regulated by anti-HER2 antibody through phosphatidylinositol 3-kinase-AKT signaling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12356910 2002 The mitotic-spindle-associated protein astrin is essential for progression through mitosis.
11724960 2001 Analysis of mitotic microtubule-associated proteins using mass spectrometry identifies astrin, a spindle-associated protein.
11549262 2001 Cloning and characterization of hMAP126, a new member of mitotic spindle-associated proteins.