Property Summary

NCBI Gene PubMed Count 5
PubMed Score 10.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 9.4e-08
Disease Target Count Z-score Confidence
epididymo-orchitis 8 4.578 2.3
Azoospermia 89 4.036 2.0
Hepatitis E 11 3.478 1.7

AA Sequence

MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKRDLLPPRTPPY      1 - 70
QVHISHQEARGPSFKICVGFLGPRWARGCSTGNEKYHLPYAARDLQTFFLPFW                      71 - 123
//

Text Mined References (6)

PMID Year Title
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11259252 2001 Organization of the human gene encoding the epididymis-specific EP2 protein variants and its relationship to defensin genes.
10698202 2000 HE2beta and HE2gamma, new members of an epididymis-specific family of androgen-regulated proteins in the human.
8167223 1994 Molecular cloning and characterization of a novel human sperm antigen (HE2) specifically expressed in the proximal epididymis.