Property Summary

NCBI Gene PubMed Count 32
PubMed Score 25.16
PubTator Score 79.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Synonym

Accession Q15506 B2R4F2 Q9BXF7
Symbols CT22
SP17
SP17-1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (18)

PMID Text
26300426 dendritic cells from human umbilical cord blood modulated for SP17 expression induced antigen-specific anti-tumor immunity against SP17(+) non-small cell lung cancer.
25739119 SP17/AKAP4/PTTG1 are expressed in both human NSCLC cell lines and primary tumors and can elicit an immunogenic response in lung cancer patients.
25600306 Sp17 and ASP cancer/testis antigens were found in ciliated cells of four ciliated hepatic foregut cysts (CHFCs). Further characterization of Sp17 and ASP in patients with CHFCs may provide significant clues for understanding the molecular mechanisms underlying their predisposition to develop squamous cell carcinomas.
24103781 NY-ESO-1 and SP17 was not significantly associated with a specific histotype, but high-level GAGE expression was more frequent in squamous cell carcinoma. GAGE expression was demonstrated to be significantly higher in stage II-IIIa than stage I NSCLC.
23923079 Sp17 is highly expressed in hepatocellular carcinoma cells
23137323 SP17 was expressed in many cancer types with an overall frequency of 12%. SP17 was most frequently expressed in a different set of cancer types than MAGE-A and GAGE antigens and rarely overlapped with these proteins.
20712874 Sperm protein 17 is highly expressed in endometrial and cervical cancers.
19744347 HSp17 plays a role in metastatic disease and resistance of epithelial ovarian carcinoma to chemotherapy
19685492 Data show that cisplatin induced decrease in Sp17 levels was due to transcriptional inhibition and cisplatin-resistant cell lines did not show this decrease in Sp17 levels in response to cisplatin treatment.
19604394 Results suggest a possible role of Sp17 in regulating sperm maturation, capacitation, acrosomal reaction and interactions with the oocyte zona pellucida during the fertilization process.
18779750 in vitro cultured, monoclonal, cytotoxic T lymphocytes (derived either from advanced OC patients or from healthy donors), specific for sperm protein 17, can eradicate human metastatic OC cells.
17230514 Overexpression of sperm protein 17 is associated with esophageal cancer
15381930 Sp17 gene expression in myeloma cells is regulated by promoter methylation
14712480 Sp17 is expressed in the cell nucleus of ovarian neoplasms
14566839 identification of a nonapeptide sequence within the Sp17 protein that is predicted to have a high binding affinity for HLA-A1 molecules
12739786 expression of Sp17, a thought to be gamete-specific protein, in the synoviocytes of 8/8 female rheumatoid arthritis patients
12393185 focuses on the characterization of the genomic organization of an intron-containing gene and establishes a new transcription model
12213290 Sp17 has different expression patterns in cancer cell lines as compared to normal non-testes tissues and a potential pathogenic role in diseased cells

AA Sequence

MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYN      1 - 70
NHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTN     71 - 140
SLQNEEKEENK                                                               141 - 151
//

Text Mined References (33)

PMID Year Title
26300426 Umbilical cord blood-derived dendritic cells infected by adenovirus for SP17 expression induce antigen-specific cytotoxic T cells against NSCLC cells.
25739119 2015 Novel antigens in non-small cell lung cancer: SP17, AKAP4, and PTTG1 are potential immunotherapeutic targets.
25600306 2015 Sperm protein 17 and AKAP-associated sperm protein cancer/testis antigens are expressed in ciliated hepatic foregut cysts.
25416956 2014 A proteome-scale map of the human interactome network.
24103781 2013 Analysis of GAGE, NY-ESO-1 and SP17 cancer/testis antigen expression in early stage non-small cell lung carcinoma.
23923079 2013 Sperm protein 17, MAGE-C1 and NY-ESO-1 in hepatocellular carcinoma: expression frequency and their correlation with clinical parameters.
23137323 2012 Limited SP17 expression within tumors diminishes its therapeutic potential.
20712874 2010 Sperm protein 17 is highly expressed in endometrial and cervical cancers.
19744347 2009 Overexpression of human sperm protein 17 increases migration and decreases the chemosensitivity of human epithelial ovarian cancer cells.
19685492 2010 Sperm protein 17 is a novel marker for predicting cisplatin response in esophageal squamous cancer cell lines.
19604394 2009 Sperm protein 17 is expressed in the sperm fibrous sheath.
18779750 2008 Sperm protein 17 is a suitable target for adoptive T-cell-based immunotherapy in human ovarian cancer.
18421703 2008 Protein kinase A RII-like (R2D2) proteins exhibit differential localization and AKAP interaction.
17551920 2007 A yeast two-hybrid system using Sp17 identified Ropporin as a novel cancer-testis antigen in hematologic malignancies.
17230514 2007 Clinical significance of sperm protein 17 expression and immunogenicity in esophageal cancer.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15381930 2004 Sp17 gene expression in myeloma cells is regulated by promoter methylation.
15257753 2004 Association of sperm protein 17 with A-kinase anchoring protein 3 in flagella.
14712480 2004 Expression of sperm protein 17 (Sp17) in ovarian cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14566839 2003 Identification of a sperm protein 17 CTL epitope restricted by HLA-A1.
12739786 2002 Developmental considerations of sperm protein 17 gene expression in rheumatoid arthritis synoviocytes.
12530914 2002 A re-evaluation of sperm protein 17 (Sp17) indicates a regulatory role in an A-kinase anchoring protein complex, rather than a unique role in sperm-zona pellucida binding.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393185 2002 Genomic organization of an intron-containing sperm protein 17 gene (Sp17-1) and an intronless pseudogene (Sp17-2) in humans: a new model.
12213290 2002 Characterization of sperm protein 17 in human somatic and neoplastic tissue.
11415432 2001 Characterization of Sp17: a ubiquitous three domain protein that binds heparin.
10591629 2000 Ropporin, a sperm-specific binding protein of rhophilin, that is localized in the fibrous sheath of sperm flagella.
9378618 1998 Molecules involved in mammalian sperm-egg interaction.
8688458 1996 Cloning and sequencing of cDNAs encoding the human sperm protein, Sp17.
7578682 1995 Sequence and localization of the mouse sperm autoantigenic protein, Sp17.
7525387 1994 Sequence of a rabbit sperm zona pellucida binding protein and localization during the acrosome reaction.