Property Summary

NCBI Gene PubMed Count 12
PubMed Score 106.84
PubTator Score 35.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.600 1.9e-02
Atopic dermatitis -1.200 2.1e-02
ependymoma -1.600 4.1e-02
medulloblastoma -1.600 2.7e-06
medulloblastoma, large-cell -1.700 3.7e-03
oligodendroglioma -1.600 2.1e-02
psoriasis -1.600 1.4e-25

 GWAS Trait (1)

Gene RIF (4)

AA Sequence

MLAATCNKIGSPSPSPSSLSDSSSSFGKGFHPWKRSSSSSSASCNVVGSSLSSFGVSGASRNGGSSSAAA      1 - 70
AAAAAAAAAAALVSDSFSCGGSPGSSAFSLTSSSAAAAAAAAAAAASSSPFANDYSVFQAPGVSGGSGGG     71 - 140
GGGGGGGSSAHSQDGSHQPVFISKVHTSVDGLQGIYPRVGMAHPYESWFKPSHPGLGAAGEVGSAGASSW    141 - 210
WDVGAGWIDVQNPNSAAALPGSLHPAAGGLQTSLHSPLGGYNSDYSGLSHSAFSSGASSHLLSPAGQHLM    211 - 280
DGFKPVLPGSYPDSAPSPLAGAGGSMLSAGPSAPLGGSPRSSARRYSGRATCDCPNCQEAERLGPAGASL    281 - 350
RRKGLHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPV    351 - 420
CNKRFMRSDHLSKHVKTHSGGGGGGGSAGSGSGGKKGSDTDSEHSAAGSPPCHSPELLQPPEPGHRNGLE    421 - 490
//

Text Mined References (13)

PMID Year Title