Property Summary

NCBI Gene PubMed Count 12
PubMed Score 93.15
PubTator Score 35.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 7.3e-37
medulloblastoma 1524 2.7e-06
medulloblastoma, large-cell 6234 3.7e-03
astrocytic glioma 2241 1.9e-02
oligodendroglioma 2849 2.1e-02
Atopic dermatitis 944 2.1e-02
ependymoma 2514 4.1e-02
Disease Target Count Z-score Confidence
Skin papilloma 4 4.299 2.1

Gene RIF (4)

PMID Text
26733200 Data suggest expression of transcription factor p8/SP8 is up-regulated in endoplasmic reticulum stress due to lipotoxicity; overexpression of SP8 up-regulates autophagy; autophagy due to lipotoxicity requires SP8; these reactions are mTOR-independent.
23967141 Genetic variants on 3q21 and in the Sp8 transcription factor gene (SP8) as susceptibility loci for psychotic disorders.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20386566 This study provided that SP8 are associated with Bipolar I in the Han Chinese population

AA Sequence

MLAATCNKIGSPSPSPSSLSDSSSSFGKGFHPWKRSSSSSSASCNVVGSSLSSFGVSGASRNGGSSSAAA      1 - 70
AAAAAAAAAAALVSDSFSCGGSPGSSAFSLTSSSAAAAAAAAAAAASSSPFANDYSVFQAPGVSGGSGGG     71 - 140
GGGGGGGSSAHSQDGSHQPVFISKVHTSVDGLQGIYPRVGMAHPYESWFKPSHPGLGAAGEVGSAGASSW    141 - 210
WDVGAGWIDVQNPNSAAALPGSLHPAAGGLQTSLHSPLGGYNSDYSGLSHSAFSSGASSHLLSPAGQHLM    211 - 280
DGFKPVLPGSYPDSAPSPLAGAGGSMLSAGPSAPLGGSPRSSARRYSGRATCDCPNCQEAERLGPAGASL    281 - 350
RRKGLHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPV    351 - 420
CNKRFMRSDHLSKHVKTHSGGGGGGGSAGSGSGGKKGSDTDSEHSAAGSPPCHSPELLQPPEPGHRNGLE    421 - 490
//

Text Mined References (13)

PMID Year Title
26733200 2016 The Transcription Factor p8 Regulates Autophagy in Response to Palmitic Acid Stress via a Mammalian Target of Rapamycin (mTOR)-independent Signaling Pathway.
23967141 2013 Genetic variants on 3q21 and in the Sp8 transcription factor gene (SP8) as susceptibility loci for psychotic disorders: a genetic association study.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20386566 2011 Genome-wide association study of bipolar I disorder in the Han Chinese population.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15533246 2004 Genomic structure and cloning of two transcript isoforms of human Sp8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14597661 2003 mBtd is required to maintain signaling during murine limb development.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.