Property Summary

NCBI Gene PubMed Count 165
PubMed Score 281.90
PubTator Score 517.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Protein-protein Interaction (3)

Gene RIF (136)

PMID Text
26807725 Sp1 and Sp3 are not only essential for the basal transcription of the ek1 gene, their accessibility to the target site on the ek1 promoter is regulated by histone protein modification in a cell line dependent manner.
26487723 result indicated that promoter binding by Sp1/Sp3 was essential, but not a limiting step, for hTERT transcription
26431879 O-GlcNAc modification of Sp3 and Sp4, but not Sp2 transcription factors negatively regulates their transcriptional activities.
26352013 Human SP1 and SP3 transcription factors regulate MALAT1 expression in hepatocellular carcinoma.
26162987 characterized two evolutionary highly conserved cis-regulatory modules (CRMs) within the proximal promoter each composed of one binding site for the transcription factors SP1 and SP3 as well as for the nuclear transcription factor Y
26012884 Sp3 was found to be a major regulator of BNIP3 in prostate cancer.
25797200 stimulates CCR7 expression during the course of dendritic cell maturation
25476526 These results suggest that XT-1 expression is refractory to the disease process and to inhibition by inflammatory cytokines and that signaling through AP-1, Sp1, and Sp3 is important in the maintenance of XT-1 levels in NP cells.
24710631 A novel GC-rich element (GRE) spanning -101/-66 sufficient for VEGFR3 transcription and activated by Sp1 and Sp3, respectively, was identified.
24315822 Sp1 and Sp3 are functionally involved as transcriptional integrators regulating the basal expression of the derived microsomal epoxide hydrolase E1b variant transcript.
24029427 Chromosome 2q31.1 is located between the genes that code for Sp3 transcription factor, which regulates expression of genes linked to glomerular function and the pathogenesis of nephropathy, and the CDCA7 transcription factor.
23996530 Results demonstrate that Sp1 and Sp3 transcription factors are the primary determinants for activating basal transcription of the ABCG2 gene and play an important role in maintaining the side population phenotype of lung cancer cells.
23540600 This study showed that SP1, SP3 and SP4 protein levels inversely correlated with negative symptoms in the cerebellum.
23523134 Cellular transcription factors Sp1, Sp3 and YY1 bind to the varicella-zoster virus ORF3 promoter, and mutation of their binding sites inhibited ORF3 gene expression.
23464785 SP3 interacts with TNIP1 promoter and contributes to its basal and inducible expression.
23401853 transcription factor Sp3 acts to reduce the expression of many genes with Sp3 binding sites in their promoters by inhibiting the transition of paused RNA PolII to productive elongation.
23326307 Findings indicate a role for transcription factor Sp3 in sarcomas as a driver for expression of the metastasis-related gene AFAP1L1 (actin filament-associated protein 1-like 1).
23223231 AP-1 and Sp3 are key regulators of IL-1beta-mediated modulation of xylosyltransferase I expression.
23133566 Transcriptional control of the multi-drug transporter ABCB1 by transcription factor Sp3 in different human tissues
23028678 the "biomarker signature" of FLIP/Sp1/Sp3 combined with Gleason score predicted disease recurrence
23000412 this study indicated that Sp3 was a major regulator of TFF2 expression.
22871965 Sp1 or Sp3 siRNA knockdown reduced 1alpha,25-dihydroxyvitamin D3-regulated hCYP24A1 promoter activity.
22682030 Sp1 and Sp3 bind to the CENPH minimal promoter and function as a regulator of the transcription of CENPH in nasopharyngeal carcinomas.
22464952 Overexpression of Sp1 and Sp3, but not NRF-1, transactivated the IRF-3 promoter activity in reporter gene assays while knocking-down of endogenous Sp1 and Sp3 by a shRNA strategy markedly inhibited IRF-3 promoter activity.
22311708 Extracellular signal-regulated kinase mitogen-activated protein kinase-dependent SOCS-3 gene induction requires c-Jun, signal transducer and activator of transcription 3, and specificity protein 3 transcription factors.
22139845 The p65 subunit of NF-kappaB inhibits COL1A1 gene transcription in human dermal and scleroderma fibroblasts through its recruitment on promoter by protein interaction with transcriptional activators (c-Krox, Sp1, and Sp3).
21919647 Ascorbic acid decreased RKO and SW480 colon cancer cell proliferation and induced apoptosis and necrosis, accompanied by downregulation of Sp1, Sp3, and Sp4 proteins.
21604172 Sp1 and Sp3 play an important role in regulating CD2AP transcription through binding to the Sp1/3 binding sites.
21554857 these data demonstrated that the expression of TGFBI is well correlated with chromatin conformation at the TGFBI promoter, and that factors Sp1 and Sp3 are the primary determinants for the control of constitutive expression of TGFBI gene.
21248046 The authors present evidence that the human endogenous retrovirus K long terminal repeat is regulated by the transcription factors Sp1 and Sp3.
21235713 results suggest that Sp3 plays a key role in the expression of NOX4 in various cell lineages in humans.
20974858 Ceramide treatment altered the in vivo binding affinity of Sp1 and Sp3 for the GLTP promoter and decreased Sp3 acetylation
20538607 Results of Sp1, Sp3, and Sp4 knockdown by RNA interference demonstrate that both p50 and p65 are Sp-regulated genes.
20519498 Transcription of the transforming growth factor beta activating integrin beta8 subunit is regulated by SP3, AP-1, and the p38 pathway
20518744 NEU3 expression is diversely regulated by Sp1/Sp3 transcription factors binding to alternative promoters, which might account for multiple modulation of gene expression.
20462637 human proximal FOXP3 promoter is controlled by activation through the TCR involving PKC and the NF-kappaB subunit p65 and by inhibition through a negative feedback loop and SP3.
20442780 the two factors Klf4 and Sp3 exert an overlapping repressor function through their binding to the Notch1 promoter.
20180024 Sp1 together with Sp3 may function as the main regulator of the basal and serum-induced transcription of CENP-W.
19309563 Sp3 gene silencing specifically hits CK18 and CK19, which are markers of oral and cervical squamous tumors.
19212434 Results suggest that full length Sp3 accumulation highlights bypass of tumour cell apoptotic capacities and is indicative of head and neck tumours' aggressiveness.
19064501 Cell confluency-induced Stat3 activation regulates NHE3 expression by recruiting Sp1 and Sp3 to the proximal NHE3 promoter region during epithelial dome formation.
18725933 Sp1/Sp3 binding at the promoter of RIL gene prevents DNA hypermethylation.
18604866 the basal activity of the human PRDM1 promoter, through which several factors, including SP1, SP3 and early growth response 1, modulate its expression through a conserved GC-box.
18593936 Curcumin also decreased bladder tumor growth in athymic nude mice bearing KU7 cells as xenografts and this was accompanied by decreased Sp1, Sp3, and Sp4 protein levels in tumors.
18543253 The co-occupancy of ERalpha and Sp1 on TFF1 promoter remains at similar level with and without estrogen, while that of ERalpha and Sp3 increased in the presence of estrogen
18522535 Sp3 bound to all five motifs on Axl, and mutation of all motifs abolished binding.
18496767 Transcription factors Sp3, ZBP-89 and NF-Y are capable of binding to the SOX18 promoter region.
18393243 Observation suggested that deficient expression of SP3 gene occurs in Chinese MS patients, and that the SP3 expression may correlate with the clinical manifestations of MS and play roles in its immunological pathogenesis.
18348986 Stat1/3 directly controls promoter P1 of the CASR, and the Stats indirectly regulate promoter P2 of the CASR via Sp1/3 in response to IL-6
18343609 Overexpression of either Sp1 or full-length Sp3 was shown to augment LAT promoter activity, while siRNA-mediated knockdown of each transcription factor was demonstrated to have an inhibitory effect.
18342022 Results show activation of the Sp3 proximal promoter upon overexpression of NF-1, c-Myb, B-Myb, c-Jun and c-Fos, and repression after overexpression of E2F/DP1.
18329191 Sp1 and Sp3 over-expression activates CD97 promoter activity in HEK293 cells.
18314536 Sp1 and Sp3 plays role in regulating the expression of human EC-SOD in the lung.
18195733 Sp1/Sp3, but not EKLF, is involved in the activation of the GATA-1 erythroid promoter, and that histones H3 and H4 are highly acetylated in this promoter region for an actively transcribed GATA-1
18065760 Interleukin-6 (IL-6) and/or soluble IL-6 receptor down-regulation of human type II collagen gene expression in articular chondrocytes requires a decrease of Sp1.Sp3 ratio and of the binding activity of both factors to the COL2A1 promoter
18053089 IL-1beta decreases type II TGFbeta receptor expression by inducing Sp3 via NFkappaB
17894944 TsA increases 5-LO promoter activity by the enhanced recruitment of Sp1 and Sp3 to the 5-LO promoter
17698844 These data suggest that the regulation of COL1A1 gene transcription in human dermal fibroblasts involves a complex machinery that implicates at least three transcription proteins, hc-Krox, Sp1, and Sp3.
17681019 functional role of Sp transcription factors in upregulating P1-directed transcription was demonstrated
17652716 Laminin repressed transcription, directed by the alpha6 gene promoter, by altering the nuclear levels of Sp1 and Sp3
17616668 EGFR activation in malignant gliomas can transcriptionally activate COX-2 expression in a process that requires p38-MAPK and Sp1/Sp3
17548428 Data show that increased generation of C18-ceramide by hCerS1 expression mediates the association and recruitment of deacetylated Sp3/HDAC1 to the hTERT promoter, resulting in local histone H3 deacetylation and repression of the promoter.
17540780 Our data suggest that the differential regulation of NHE3 gene expression by NaB and IFN-gamma/TNF-alpha is mediated through alternative pathways that converge on Sp1/Sp3.
17343736 in human osteoblast-like MG63 cells, Sp1 and Sp3 stimulate basal PDPN transcription in a concerted, yet independent manner.
17297470 These data suggest Pdcd4 as a new negative regulator of intravasation, and qas the invasion-related gene u-PAR. It is the first study to implicate Pdcd4 regulation of gene expression via Sp1/Sp3.
17241874 Sp3 binds to the gamma-ENaC promoter and Sp3 binding is enhanced by butyrate
16965966 WFS1 minimal promoter contains two DNA binding motifs (GC boxes) for the transcription factors Sp1/3/4 and binding of both Sp1 and Sp3 was demonstrated at both motifs in vitro and in vivo.
16807381 HSD17B2 expression in endometrial epithelial cells, and, therefore, estrogen inactivation, is regulated by SP1 and SP3
16806531 Sp1 is a strong activator, while Sp3 by its own is a weak activator of the DPYD promoter.
16760259 These data indicate that IFN-gamma and TNF-alpha may repress the NHE3 promoter activity in C2BBe1 cells by PKA-mediated phosphorylation of Sp1 and Sp3 transcription factors.
16677608 Nevertheless, by gel shift assays, Sp1 and Sp3 were not found to be responsible for the protein-DNA complexes formed by the GC-rich sequence.
16672217 Sp3 and Sp1 transcription factors have a crutial role in the expression of Protein S gene
16671893 PADI3 expression is driven by Sp3 bindin to the promoter region
16603733 Sp1 and Sp3 are principal mediators of hyaluronan synthase 2 constitutive transcription
16574784 Sp3 and Sp4 cooperatively interact with ERalpha to activate VEGFR2
16529657 identified and characterized the P2X1 promoter utilized in MEG-01 cells and showed that binding of Sp1/3 and NF-1 to elements in the direct vicinity of the transcription start site is essential for basal transcription
16339759 in the absence of IFN treatment, activation of PKR basal expression is mediated by Sp1 and Sp3 proteins in a cooperative manner
16150893 increased pAPCP promoter activity in the MCF10A cell line in response to DMBA treatment is mediated by Sp3
16081043 Sp3 D-domain modulates its protein levels and activation of the p21(CIP1/WAF1) promoter
16061936 Transcription factors Oct-1, Oct-2, PU.1, Sp1, and Sp3 are recruited to the HS7 regulatory site in the pol coding region, suggesting that Oct-1, Oct-2, PU.1, Sp1, and Sp3 indirectly interact with HIV-1 Pol
16024108 Results indicate important role for Sp1, Sp3, and NF-Y in transcription regulation of Sp3 proximal promotor
15987735 Demonstration of the different intranuclear features of Sp1 and Sp3 provides further evidence that Sp3 is not a functional equivalent of Sp1.
15979574 Our results suggest that MUC6 transcription is regulated by NFkappaB and Sp family members.
15951564 Sp1 and Sp3 have roles in regulation of human telomerase reverse transcriptase promoter activity by the bioactive sphingolipid ceramide
15869407 Transcription factors Oct-1, Oct-2, PU.1, Sp1, and Sp3 are recruited to the HS7 regulatory site in the pol coding region, suggesting that Oct-1, Oct-2, PU.1, Sp1, and Sp3 indirectly interact with HIV-1 Pol
15831526 cytochrome b5 gene transcription is regulated by Sp3, GATA-6, and steroidogenic factor 1 in human adrenal NCI-H295A cells
15821099 Data demonstrate that the constitutive activity of the human melanocortin-4 receptor promoter is dependent upon Sp1 and 3 transcription factors.
15816870 Sp3 is a strong activator of dopamine transporter transcriptional activity.
15777284 PARP-1 expression appeared to be co-ordinated with that of Sp1 and Sp3 in primary cultured cells, suggesting that PARP-1 may play some important functions during the proliferative burst that characterizes wound healing.
15747776 10 genes were down-regulated following treatment of the T-ALL cells with 0.15 and 1.5 microg/mL of metal ores at 72 h. DNA-binding transcriptional activator activity.
15706661 HIV-1 Tat regulates the SOD2 basal promoter by altering Sp1/Sp3 binding activity
15706661 Transcription factors Oct-1, Oct-2, PU.1, Sp1, and Sp3 are recruited to the HS7 regulatory site in the pol coding region, suggesting that Oct-1, Oct-2, PU.1, Sp1, and Sp3 indirectly interact with HIV-1 Pol
15666829 Proximal promoter of GIP-R gene contains a GC-rich region capable of binding to Sp1 and SP3.
15572681 SP3 protein negatively regulates beta myosin heavy chain gene expression during skeletal muscle inactivity.
15523672 results show that there are genuine Sp1/Sp3 or Egr-1 controlled genes showing no cross-regulation of Sp1/Sp3 and Egr-1 through the same DNA-binding site
15494207 Sp3 isoforms are sumoylated in vivo and this post-translational modification plays an important role in the regulation of Sp3-mediated transcription.
15466927 The reduced binding affinity of Sp1/Sp3 to the T allele explain earlier observations of a reduced t-PA release and an increased risk of myocardial infarction in individuals carrying this allele.
15247906 Sp1 and Sp3 proteins play a physiologically important role in positively and negatively regulating the 15-LOX2 gene expression, respectively.
15247228 four isoforms derive from alternative translational start sites at positions 1, 37, 856, and 907; the transcriptional activity of all the Sp3 isoforms is regulated by SUMO modification
15118068 human secretin gene is controlled by the Sp1/Sp3 transcription factors ratio
15111490 PPARgamma1 has bifunctional properties in the regulation of KDR gene expression mediated via interaction with both Sp1 and Sp3
15107420 Sp3 binding is regulated by methylation in the core-promoter region of the chondromodulin-I gene
14767558 Sp3 isoform ratios and activity are controlled at the translational level, which regulates expression of genes during mitosis and has effects on cell cycle regulation and tumorigenesis
14767471 An SP3 binding site in the IGFBP4 gene was identified and the role of SP3 in regulating its promoter activity in CaCo-2 cells was studied.
14766015 S-nitrosoglutathione increases Sp3 binding to DNA and transcription of CFTR at physiological concentrations, but inhibits Sp3 binding and CFTR transcription at nitrosative stress levels.
14742449 the cooperation of HIF-1 with Sp1/Sp3 confers transcriptional activation under hypoxia to RORalpha4
14697235 SP3 acts as a positive regulator on the core promoter of human ZPK gene
14645238 E2F and Sp1/Sp3 synergize but are not sufficient to activate the MYCN gene in neuroblastoma
14623259 In conclusion, we provide evidence for AML-1, PU.1, and Sp3 cooperatively and directly mediating BPI-expression during myeloid differentiation.
14608051 Biotin affects gene expression in Jurkaat cells.
12972613 TFIIB intewracts with SP1/SP3 at the SP1 site.
12911579 HNF4-alpha, HNF3-beta and Sp1/Sp3 are important in regulation of prothrombin expression
12855685 Sp3 and Sp1 have roles in regulating monoamine oxidase B in human tumor cells
12837748 Acetylation acts as a switch that controls the repressor and activator role of Sp3.
12818425 The results indicate that Sp1 is the protein mediating the basal transcription of MGST1. It appears that both the Sp1 and Sp3 proteins are important for the basal expression of PGES
12730302 Sp1 and Sp3 regulate human CETP promoter activity through three Sp1/Sp3 binding sites in a distinct manner
12694199 This protein and Sp1 are involved in up-regulation of human deoxyribonuclease II transcription during differentiation of HL-60 cells.
12664565 Regulates leukotreiene C4 synthase gene expression in mononuclear phagocytes.
12576329 results suggest that oxidized phospholipids inhibit transcription of the thrombomodulin gene in vascular endothelium by inhibiting the binding of retinoic acid receptor beta-retinoid x receptor alpha heterodimer and Sp1 and Sp3 to thrombomodulin promoter
12509426 role in regulating vascular endothelial growth factor-A gene transcription by activating two proximal GC-rich promoter elements
12411611 5' UTR of Sp3 transcription factor
12378384 This protein plays a role in the identification of regulatory elements in the human adipose most abundant gene transcript-1(apM-1) promoter.
12297462 role of transcription factors Sp1 and Sp3 in the regulation of telomerase activity and human telomerase reverse transcriptase (hTERT) in Jurkat T cells
12297010 Use of non-AUG (AUA) translation initiation site and alternate downstream start sites, results in multiple SP3 isoforms.
12186868 TGF-beta1 inhibition of COL2A1 gene transcription in articular chondrocytes is mediated by an increase of the Sp3/Sp1 ratio and by the repression of Sp1 transactivating effects on that gene
12176973 CK2 phosphorylation of HDAC2 recruited by Sp1 or Sp3 could regulate HDAC activity and alter the balance of histone deacetylase and histone acetyltransferase activities and dynamic chromatin remodeling of estrogen-regulated genes.
12151407 Results suggest that Sp1 and Sp3 associate with the hTERT promoter, recruiting HDAC for the localized deacetylation of nucleosomal histones and transcriptional silencing of the hTERT gene in normal human somatic cells.
12133007 cooperation with hepatocyte nuclear factor-4 leads to transcriptional activation of the human haem oxygenase-1 gene promoter in a hepatoma cell line
11867623 Role of Sp1 and Sp3 in the nutrient-regulated expression of the human asparagine synthetase gene
11850421 role in regulating 11beta-hydroxysteroid dehydrogenase type 2 promoter
11839742 role in identifying sterol-indendent regulatory elements in human ATP-binding cassette transporter A1 promoter
11796707 role in interferon-gamma mediated suppression of macrophage lipoprotein lipase gene transcription
11773047 Sp3- mediated transcriptional repression is due, at least in part, to competition for promoter-specific transcription factors
11447232 Transcription factor Sp3 blocked the Sp1 induction of COL2A1 promoter activity
9388268 Transcription factors Oct-1, Oct-2, PU.1, Sp1, and Sp3 are recruited to the HS7 regulatory site in the pol coding region, suggesting that Oct-1, Oct-2, PU.1, Sp1, and Sp3 indirectly interact with HIV-1 Pol
7800480 Transcription factors Oct-1, Oct-2, PU.1, Sp1, and Sp3 are recruited to the HS7 regulatory site in the pol coding region, suggesting that Oct-1, Oct-2, PU.1, Sp1, and Sp3 indirectly interact with HIV-1 Pol

AA Sequence

MTAPEKPVKQEEMAALDVDSGGGGGGGGGHGEYLQQQQQHGNGAVAAAAAAQDTQPSPLALLAATCSKIG      1 - 70
PPSPGDDEEEAAAAAGAPAAAGATGDLASAQLGGAPNRWEVLSATPTTIKDEAGNLVQIPSAATSSGQYV     71 - 140
LPLQNLQNQQIFSVAPGSDSSNGTVSSVQYQVIPQIQSADGQQVQIGFTGSSDNGGINQESSQIQIIPGS    141 - 210
NQTLLASGTPSANIQNLIPQTGQVQVQGVAIGGSSFPGQTQVVANVPLGLPGNITFVPINSVDLDSLGLS    211 - 280
GSSQTMTAGINADGHLINTGQAMDSSDNSERTGERVSPDINETNTDTDLFVPTSSSSQLPVTIDSTGILQ    281 - 350
QNTNSLTTSSGQVHSSDLQGNYIQSPVSEETQAQNIQVSTAQPVVQHLQLQESQQPTSQAQIVQGITPQT    351 - 420
IHGVQASGQNISQQALQNLQLQLNPGTFLIQAQTVTPSGQVTWQTFQVQGVQNLQNLQIQNTAAQQITLT    421 - 490
PVQTLTLGQVAAGGAFTSTPVSLSTGQLPNLQTVTVNSIDSAGIQLHPGENADSPADIRIKEEEPDPEEW    491 - 560
QLSGDSTLNTNDLTHLRVQVVDEEGDQQHQEGKRLRRVACTCPNCKEGGGRGTNLGKKKQHICHIPGCGK    561 - 630
VYGKTSHLRAHLRWHSGERPFVCNWMYCGKRFTRSDELQRHRRTHTGEKKFVCPECSKRFMRSDHLAKHI    631 - 700
KTHQNKKGIHSSSTVLASVEAARDDTLITAGGTTLILANIQQGSVSGIGTVNTSATSNQDILTNTEIPLQ    701 - 770
LVTVSGNETME                                                               771 - 781
//

Text Mined References (182)

PMID Year Title
26807725 2016 Sp1 and Sp3 Are the Transcription Activators of Human ek1 Promoter in TSA-Treated Human Colon Carcinoma Cells.
26487723 2015 Human Telomerase Reverse Transcriptase (hTERT) Transcription Requires Sp1/Sp3 Binding to the Promoter and a Permissive Chromatin Environment.
26431879 2015 O-GlcNAc modification of Sp3 and Sp4 transcription factors negatively regulates their transcriptional activities.
26352013 2015 Sp1 cooperates with Sp3 to upregulate MALAT1 expression in human hepatocellular carcinoma.
26162987 2015 Functional interplay of SP family members and nuclear factor Y is essential for transcriptional activation of the human Calreticulin gene.
26012884 2015 Transcriptional regulation of BNIP3 by Sp3 in prostate cancer.
25797200 2015 NFAT-1, Sp-1, Sp-3, and miR-21: New regulators of chemokine C receptor 7 expression in mature human dendritic cells.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25476526 2015 Xylosyltransferase-1 expression is refractory to inhibition by the inflammatory cytokines tumor necrosis factor ? and IL-1? in nucleus pulposus cells: novel regulation by AP-1, Sp1, and Sp3.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
24710631 2014 Transcription of the vascular endothelial growth factor receptor-3 (VEGFR3) gene is regulated by the zinc finger proteins Sp1 and Sp3 and is under epigenetic control: transcription of vascular endothelial growth factor receptor 3.
24315822 2014 Sp1 and Sp3 transcription factors regulate the basal expression of human microsomal epoxide hydrolase (EPHX1) through interaction with the E1b far upstream promoter.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24029427 2013 Chromosome 2q31.1 associates with ESRD in women with type 1 diabetes.
23996530 2013 Transcription factors Sp1 and Sp3 regulate expression of human ABCG2 gene and chemoresistance phenotype.
23974705 2013 A genome-wide association study of chronic otitis media with effusion and recurrent otitis media identifies a novel susceptibility locus on chromosome 2.
23540600 2013 Analysis of Sp transcription factors in the postmortem brain of chronic schizophrenia: a pilot study of relationship to negative symptoms.
23523134 2013 Regulation of the varicella-zoster virus ORF3 promoter by cellular and viral factors.
23464785 2013 Sp sites contribute to basal and inducible expression of the human TNIP1 (TNF?-inducible protein 3-interacting protein 1) promoter.
23401853 2013 Transcription factor Sp3 represses expression of p21CIP¹ via inhibition of productive elongation by RNA polymerase II.
23326307 2013 The transcription factor Sp3 regulates the expression of a metastasis-related marker of sarcoma, actin filament-associated protein 1-like 1 (AFAP1L1).
23223231 2013 Regulation of xylosyltransferase I gene expression by interleukin 1? in human primary chondrocyte cells: mechanism and impact on proteoglycan synthesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23133566 2012 Transcriptional control of the multi-drug transporter ABCB1 by transcription factor Sp3 in different human tissues.
23028678 2012 Predictive value of Sp1/Sp3/FLIP signature for prostate cancer recurrence.
23000412 2012 The regulation of trefoil factor 2 expression by the transcription factor Sp3.
22871965 2012 Phorbol esters enhance 1?,25-dihydroxyvitamin D3-regulated 25-hydroxyvitamin D-24-hydroxylase (CYP24A1) gene expression through ERK-mediated phosphorylation of specific protein 3 (Sp3) in Caco-2 cells.
22682030 2012 Sp1 and Sp3 are involved in the full transcriptional activity of centromere protein H in human nasopharyngeal carcinoma cells.
22464952 2012 Transcription factors Sp1 and Sp3 regulate basal transcription of the human IRF-3 gene.
22311708 2012 Extracellular signal-regulated kinase mitogen-activated protein kinase-dependent SOCS-3 gene induction requires c-Jun, signal transducer and activator of transcription 3, and specificity protein 3 transcription factors.
22139845 2012 The p65 subunit of NF-?B inhibits COL1A1 gene transcription in human dermal and scleroderma fibroblasts through its recruitment on promoter by protein interaction with transcriptional activators (c-Krox, Sp1, and Sp3).
21919647 2011 Pharmacologic doses of ascorbic acid repress specificity protein (Sp) transcription factors and Sp-regulated genes in colon cancer cells.
21746878 2011 Cooperative transcriptional activation by Klf4, Meis2, and Pbx1.
21604172 2012 Transcriptional control of human CD2AP expression: the role of Sp1 and Sp3.
21554857 2011 Accessible chromatin structure permits factors Sp1 and Sp3 to regulate human TGFBI gene expression.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21248046 2011 Expression of the human endogenous retrovirus (HERV) group HML-2/HERV-K does not depend on canonical promoter elements but is regulated by transcription factors Sp1 and Sp3.
21235713 2011 Sp3 transcription factor is crucial for transcriptional activation of the human NOX4 gene.
20974858 2011 Human glycolipid transfer protein gene (GLTP) expression is regulated by Sp1 and Sp3: involvement of the bioactive sphingolipid ceramide.
20538607 2010 Inhibition of NFkappaB and pancreatic cancer cell and tumor growth by curcumin is dependent on specificity protein down-regulation.
20519498 2010 Transcription of the transforming growth factor beta activating integrin beta8 subunit is regulated by SP3, AP-1, and the p38 pathway.
20518744 2010 Regulation of plasma-membrane-associated sialidase NEU3 gene by Sp1/Sp3 transcription factors.
20462637 2010 Proximal human FOXP3 promoter transactivated by NF-kappaB and negatively controlled by feedback loop and SP3.
20442780 2010 Differential control of Notch1 gene transcription by Klf4 and Sp3 transcription factors in normal versus cancer-derived keratinocytes.
20180024 2010 Sp1 and Sp3 mediate basal and serum-induced expression of human CENP-W.
20091743 2010 Transcriptional regulation of human FE65, a ligand of Alzheimer's disease amyloid precursor protein, by Sp1.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19309563 Effect of SP3 silencing on cytokeratin expression pattern in HPV-positive cells.
19212434 2009 Dual role of Sp3 transcription factor as an inducer of apoptosis and a marker of tumour aggressiveness.
19064501 2009 Cell confluency-induced Stat3 activation regulates NHE3 expression by recruiting Sp1 and Sp3 to the proximal NHE3 promoter region during epithelial dome formation.
18725933 2008 An Sp1/Sp3 binding polymorphism confers methylation protection.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18617891 2008 SUMO-modified Sp3 represses transcription by provoking local heterochromatic gene silencing.
18604866 2008 Transcription of PRDM1, the master regulator for plasma cell differentiation, depends on an SP1/SP3/EGR-1 GC-box.
18593936 2008 Curcumin decreases specificity protein expression in bladder cancer cells.
18543253 2008 Association of Sp3 and estrogen receptor alpha with the transcriptionally active trefoil factor 1 promoter in MCF-7 breast cancer cells.
18522535 2008 The human receptor tyrosine kinase Axl gene--promoter characterization and regulation of constitutive expression by Sp1, Sp3 and CpG methylation.
18496767 2009 ZBP-89 and Sp3 down-regulate while NF-Y up-regulates SOX18 promoter activity in HeLa cells.
18393243 2008 [Deficient mRNA expression of specific protein 3 gene in peripheral blood mononuclear cells from patients with multiple sclerosis].
18348986 2008 The proinflammatory cytokine, interleukin-6, up-regulates calcium-sensing receptor gene transcription via Stat1/3 and Sp1/3.
18343609 2008 Transcription of the LAT gene is regulated by multiple binding sites for Sp1 and Sp3.
18342022 2008 Transcriptional regulation of the 5'-flanking region of the human transcription factor Sp3 gene by NF-1, c-Myb, B-Myb, AP-1 and E2F.
18329191 2008 Transcriptional regulation of the human CD97 promoter by Sp1/Sp3 in smooth muscle cells.
18314536 2008 Transcription factors sp1 and sp3 regulate expression of human extracellular superoxide dismutase in lung fibroblasts.
18195733 2008 Involvement of Sp1/Sp3 in the activation of the GATA-1 erythroid promoter in K562 cells.
18187045 2008 Nuclear organization and chromatin dynamics--Sp1, Sp3 and histone deacetylases.
18065760 2008 Interleukin-6 (IL-6) and/or soluble IL-6 receptor down-regulation of human type II collagen gene expression in articular chondrocytes requires a decrease of Sp1.Sp3 ratio and of the binding activity of both factors to the COL2A1 promoter.
18053089 NFkappaB mediates IL-1beta-induced down-regulation of TbetaRII through the modulation of Sp3 expression.
17894944 2007 The histone deacetylase inhibitor trichostatin A mediates upregulation of 5-lipoxygenase promoter activity by recruitment of Sp1 to distinct GC-boxes.
17698844 2007 Human collagen Krox up-regulates type I collagen expression in normal and scleroderma fibroblasts through interaction with Sp1 and Sp3 transcription factors.
17681019 2007 Transcriptional activity and Sp 1/3 transcription factor binding to the P1 promoter sequences of the human AbetaH-J-J locus.
17652716 2007 Laminin reduces expression of the human alpha6 integrin subunit gene by altering the level of the transcription factors Sp1 and Sp3.
17616668 2007 EGFR activation results in enhanced cyclooxygenase-2 expression through p38 mitogen-activated protein kinase-dependent activation of the Sp1/Sp3 transcription factors in human gliomas.
17548428 2007 Mechanisms of ceramide-mediated repression of the human telomerase reverse transcriptase promoter via deacetylation of Sp3 by histone deacetylase 1.
17540780 2007 Involvement of Sp1 and Sp3 in differential regulation of human NHE3 promoter activity by sodium butyrate and IFN-gamma/TNF-alpha.
17343736 2007 Sp1/Sp3 and DNA-methylation contribute to basal transcriptional activation of human podoplanin in MG63 versus Saos-2 osteoblastic cells.
17297470 2007 Tumor suppressor Pdcd4 inhibits invasion/intravasation and regulates urokinase receptor (u-PAR) gene expression via Sp-transcription factors.
17241874 2007 Butyrate induces intestinal sodium absorption via Sp3-mediated transcriptional up-regulation of epithelial sodium channels.
17130167 2006 Evidence of the neuron-restrictive silencer factor (NRSF) interaction with Sp3 and its synergic repression to the mu opioid receptor (MOR) gene.
16965966 2006 The characterisation of the human Wolfram syndrome gene promoter demonstrating regulation by Sp1 and Sp3 transcription factors.
16807381 2006 SP1 and SP3 mediate progesterone-dependent induction of the 17beta hydroxysteroid dehydrogenase type 2 gene in human endometrium.
16806531 2006 The role of Sp1 and Sp3 in the constitutive DPYD gene expression.
16781829 2006 The modification of Sp3 isoforms by SUMOylation has differential effects on the SRC1A promoter.
16760259 2006 IFN-gamma and TNF-alpha regulate human NHE3 gene expression by modulating the Sp family transcription factors in human intestinal epithelial cell line C2BBe1.
16696853 2006 A yeast 2-hybrid analysis of human GTP cyclohydrolase I protein interactions.
16677608 2006 Involvement of the GC-rich sequence and specific proteins (Sp1/Sp3) in the basal transcription activity of neurogranin gene.
16672217 2006 The constitutive expression of anticoagulant protein S is regulated through multiple binding sites for Sp1 and Sp3 transcription factors in the protein S gene promoter.
16671893 2006 NF-Y and Sp1/Sp3 are involved in the transcriptional regulation of the peptidylarginine deiminase type III gene (PADI3) in human keratinocytes.
16603733 2006 Sp1 and Sp3 mediate constitutive transcription of the human hyaluronan synthase 2 gene.
16574784 2006 Vascular endothelial growth factor receptor-2 expression is induced by 17beta-estradiol in ZR-75 breast cancer cells by estrogen receptor alpha/Sp proteins.
16529657 2006 Sp1/3 and NF-1 mediate basal transcription of the human P2X1 gene in megakaryoblastic MEG-01 cells.
16339759 2006 Activation of the RNA-dependent protein kinase PKR promoter in the absence of interferon is dependent upon Sp proteins.
16150893 2006 7,12-Dimethylbenzanthracene-dependent transcriptional regulation of adenomatous polyposis coli (APC) gene expression in normal breast epithelial cells is mediated by GC-box binding protein Sp3.
16081043 2005 The D-domain of Sp3 modulates its protein levels and activation of the p21(CIP1/WAF1) promoter.
16024108 2005 Characterization of the 5'-flanking region of the human transcription factor Sp3 gene.
15987735 2005 Differential intranuclear organization of transcription factors Sp1 and Sp3.
15979574 2005 Upregulation of MUC6 mucin gene expression by NFkappaB and Sp factors.
15951564 2005 Sp1/Sp3-dependent regulation of human telomerase reverse transcriptase promoter activity by the bioactive sphingolipid ceramide.
15831526 2005 Regulation of cytochrome b5 gene transcription by Sp3, GATA-6, and steroidogenic factor 1 in human adrenal NCI-H295A cells.
15821099 2005 Expression of the human melanocortin-4 receptor gene is controlled by several members of the Sp transcription factor family.
15816870 2005 Sp1 and Sp3 activate transcription of the human dopamine transporter gene.
15790310 2005 Physical and functional interactions between members of the tumour suppressor p53 and the Sp families of transcription factors: importance for the regulation of genes involved in cell-cycle arrest and apoptosis.
15777284 2005 Regulation of the poly(ADP-ribose) polymerase-1 gene expression by the transcription factors Sp1 and Sp3 is under the influence of cell density in primary cultured cells.
15747776 2003 Dose-dependent transcriptome changes by metal ores on a human acute lymphoblastic leukemia cell line.
15706661 2004 HIV-1 Tat regulates the SOD2 basal promoter by altering Sp1/Sp3 binding activity.
15666829 2004 The Sp transcription factor family is involved in the cellular expression of the human GIP-R gene promoter.
15572681 2004 Sp3 proteins negatively regulate beta myosin heavy chain gene expression during skeletal muscle inactivity.
15554904 2005 Sp3 is involved in the regulation of SOCS3 gene expression.
15523672 2005 Specificity of transcriptional regulation by the zinc finger transcription factors Sp1, Sp3, and Egr-1.
15494207 2005 Sumoylation of internally initiated Sp3 isoforms regulates transcriptional repression via a Trichostatin A-insensitive mechanism.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15474306 2004 Human transcription factor Sp3: genomic structure, identification of a processed pseudogene, and transcript analysis.
15466927 2005 The t-PA -7351C>T enhancer polymorphism decreases Sp1 and Sp3 protein binding affinity and transcriptional responsiveness to retinoic acid.
15247906 2004 Evidence that Sp1 positively and Sp3 negatively regulate and androgen does not directly regulate functional tumor suppressor 15-lipoxygenase 2 (15-LOX2) gene expression in normal human prostate epithelial cells.
15247228 2004 Complexity of translationally controlled transcription factor Sp3 isoform expression.
15118068 2004 Regulation of the human secretin gene is controlled by the combined effects of CpG methylation, Sp1/Sp3 ratio, and the E-box element.
15111490 2004 Bifunctional properties of peroxisome proliferator-activated receptor gamma1 in KDR gene regulation mediated via interaction with both Sp1 and Sp3.
15107420 2004 Methylation in the core-promoter region of the chondromodulin-I gene determines the cell-specific expression by regulating the binding of transcriptional activator Sp3.
14979875 2004 Co-operative interactions between NFAT (nuclear factor of activated T cells) c1 and the zinc finger transcription factors Sp1/Sp3 and Egr-1 regulate MT1-MMP (membrane type 1 matrix metalloproteinase) transcription by glomerular mesangial cells.
14970236 2004 NF-kappaB site interacts with Sp factors and up-regulates the NR1 promoter during neuronal differentiation.
14767558 2004 Role of an internal ribosome entry site in the translational control of the human transcription factor Sp3.
14767471 2004 Identification of a novel SP3 binding site in the promoter of human IGFBP4 gene: role of SP3 and AP-1 in regulating promoter activity in CaCo2 cells.
14766015 2004 Concentration-dependent effects of endogenous S-nitrosoglutathione on gene regulation by specificity proteins Sp3 and Sp1.
14742449 2004 Hypoxia-induced activation of the retinoic acid receptor-related orphan receptor alpha4 gene by an interaction between hypoxia-inducible factor-1 and Sp1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14697235 2004 SP3 acts as a positive regulator on the core promoter of human ZPK gene.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
14645238 2004 E2F and Sp1/Sp3 Synergize but are not sufficient to activate the MYCN gene in neuroblastomas.
14623259 2003 AML-1, PU.1, and Sp3 regulate expression of human bactericidal/permeability-increasing protein.
14608051 2003 The nuclear abundance of transcription factors Sp1 and Sp3 depends on biotin in Jurkat cells.
12972613 2003 Repression of the luteinizing hormone receptor gene promoter by cross talk among EAR3/COUP-TFI, Sp1/Sp3, and TFIIB.
12943729 2003 Dual mechanisms of regulation of transcription of luteinizing hormone receptor gene by nuclear orphan receptors and histone deacetylase complexes.
12911579 2003 Functional characterization of transcription factor binding sites for HNF1-alpha, HNF3-beta (FOXA2), HNF4-alpha, Sp1 and Sp3 in the human prothrombin gene enhancer.
12855685 2003 Decreased methylation and transcription repressor Sp3 up-regulated human monoamine oxidase (MAO) B expression during Caco-2 differentiation.
12837748 2003 Acetylated sp3 is a transcriptional activator.
12818425 2003 Basal expression of the human MAPEG members microsomal glutathione transferase 1 and prostaglandin E synthase genes is mediated by Sp1 and Sp3.
12771217 2003 ZBP-89 represses vimentin gene transcription by interacting with the transcriptional activator, Sp1.
12730302 2003 Regulation of human CETP gene expression: role of SP1 and SP3 transcription factors at promoter sites -690, -629, and -37.
12694199 2003 Sp1 and Sp3 are involved in up-regulation of human deoxyribonuclease II transcription during differentiation of HL-60 cells.
12664565 2002 Regulation of leukotriene C4 synthase gene expression by SP1 and SP3 in mononuclear phagocytes.
12576329 2003 Oxidized phospholipids in oxidized low-density lipoprotein down-regulate thrombomodulin transcription in vascular endothelial cells through a decrease in the binding of RARbeta-RXRalpha heterodimers and Sp1 and Sp3 to their binding sequences in the TM promoter.
12560508 2003 Reciprocal regulation of expression of the human adenosine 5'-triphosphate binding cassette, sub-family A, transporter 2 (ABCA2) promoter by the early growth response-1 (EGR-1) and Sp-family transcription factors.
12509426 2003 Oxidative stress regulates vascular endothelial growth factor-A gene transcription through Sp1- and Sp3-dependent activation of two proximal GC-rich promoter elements.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12419227 2002 SUMO-1 modification represses Sp3 transcriptional activation and modulates its subnuclear localization.
12411611 2002 5' genomic structure of human Sp3.
12378384 2002 Identification of regulatory elements in the human adipose most abundant gene transcript-1 ( apM-1) promoter: role of SP1/SP3 and TNF-alpha as regulatory pathways.
12356736 2002 Transcription factor Sp3 is silenced through SUMO modification by PIAS1.
12297462 2002 Regulation of telomerase activity in Jurkat T cells by transcription factors Sp1 and Sp3.
12297010 2002 AUA as a translation initiation site in vitro for the human transcription factor Sp3.
12186868 2002 Down-regulation of human type II collagen gene expression by transforming growth factor-beta 1 (TGF-beta 1) in articular chondrocytes involves SP3/SP1 ratio.
12176973 2002 The transcriptional repressor Sp3 is associated with CK2-phosphorylated histone deacetylase 2.
12151407 2002 Sp1 and Sp3 recruit histone deacetylase to repress transcription of human telomerase reverse transcriptase (hTERT) promoter in normal human somatic cells.
12133007 2002 Co-operation of the transcription factor hepatocyte nuclear factor-4 with Sp1 or Sp3 leads to transcriptional activation of the human haem oxygenase-1 gene promoter in a hepatoma cell line.
12071960 2002 Regulation of transcription of the Dnmt1 gene by Sp1 and Sp3 zinc finger proteins.
12054741 2002 Induction of murine H-rev107 gene expression by growth arrest and histone acetylation: involvement of an Sp1/Sp3-binding GC-box.
12004059 2002 POZ domain transcription factor, FBI-1, represses transcription of ADH5/FDH by interacting with the zinc finger and interfering with DNA binding activity of Sp1.
11867623 2002 Role of Sp1 and Sp3 in the nutrient-regulated expression of the human asparagine synthetase gene.
11850421 2002 In vivo footprinting of the human 11beta-hydroxysteroid dehydrogenase type 2 promoter: evidence for cell-specific regulation by Sp1 and Sp3.
11839742 2002 Identification of sterol-independent regulatory elements in the human ATP-binding cassette transporter A1 promoter: role of Sp1/3, E-box binding factors, and an oncostatin M-responsive element.
11812829 2001 Transcription factor Sp3 is regulated by acetylation.
11796707 2002 A novel role of Sp1 and Sp3 in the interferon-gamma -mediated suppression of macrophage lipoprotein lipase gene transcription.
11447232 2001 Sp3 represses the Sp1-mediated transactivation of the human COL2A1 gene in primary and de-differentiated chondrocytes.
11237613 2001 Sp1 and Sp3 physically interact and co-operate with GABP for the activation of the utrophin promoter.
10816575 2000 Inhibition of vascular endothelial growth factor expression in HEC1A endometrial cancer cells through interactions of estrogen receptor alpha and Sp3 proteins.
10547281 1999 Transcription factors of the Sp1 family: interaction with E2F and regulation of the murine thymidine kinase promoter.
10391891 1999 Functional interactions between Sp1 or Sp3 and the helicase-like transcription factor mediate basal expression from the human plasminogen activator inhibitor-1 gene.
9388268 1997 COUP-TF and Sp1 interact and cooperate in the transcriptional activation of the human immunodeficiency virus type 1 long terminal repeat in human microglial cells.
9329821 1997 Differentiation-dependent and cell-specific regulation of the hIGFBP-1 gene in human endometrium.
9278495 1997 Sp3 is a transcriptional activator of the human alpha2(I) collagen gene.
9224612 1997 Sp3 encodes multiple proteins that differ in their capacity to stimulate or repress transcription.
8938460 1996 Human Sp3 transcriptional regulator gene (SP3) maps to chromosome 2q31.
8896459 1996 An inhibitor domain in Sp3 regulates its glutamine-rich activation domains.
8845379 1995 Sp1 trans-activation of cell cycle regulated promoters is selectively repressed by Sp3.
7800480 1994 Different members of the Sp1 multigene family exert opposite transcriptional regulation of the long terminal repeat of HIV-1.
7732011 1995 Functional interactions between the retinoblastoma (Rb) protein and Sp-family members: superactivation by Rb requires amino acids necessary for growth suppression.
1454515 1992 Cloning by recognition site screening of two novel GT box binding proteins: a family of Sp1 related genes.
1341900 1992 Cloning of GT box-binding proteins: a novel Sp1 multigene family regulating T-cell receptor gene expression.